Property Summary

NCBI Gene PubMed Count 122
Grant Count 99
R01 Count 38
Funding $14,794,523.72
PubMed Score 766.65
PubTator Score 276.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 2.900 0.000
osteosarcoma -3.412 0.000
cystic fibrosis 1.105 0.006
tuberculosis -1.900 0.000
colon cancer 1.200 0.003
interstitial cystitis 2.800 0.036
ulcerative colitis 2.200 0.010
psoriasis 2.500 0.000

Synonym

Accession Q13007 Q2YHE5 Q53XZ7 Q5YLN8 Q96DB0 Q96KG4 IL-24
Symbols C49A
FISP
MDA7
MOB5
ST16
IL10B

Gene

 IMPC Term (1)

Gene RIF (105)

PMID Text
26977011 IL20R1 correlated with prognosis of patients with pancreatic cancer, and mediates pancreatic cancer cell growth and migration. It may be a potential biomarker for IL24 molecular-targeted therapy.
26486636 This study demonstrated that IL-19 and IL-24 are associated with the modulation of T-cell responses in filarial infections.
26367324 The anti-viral effect of IL-24 correlated with caspase-3 activation and could be blocked by a pan-caspase inhibitor and by small interfering RNA (siRNA) directed towards TLR3.
26168134 This study indicates that IL-24 upregulates expression and activation of double-stranded RNA-activated protein kinase, further increasing expression and activation of eIF-2alpha, and decreasing Bcl-2 to promote apoptosis.
26097559 gene transfer to drive IL24 expression in chronic myeloid leukemia cell lines resulted in cytotoxicity specifically to cancer cells.
25778843 IL-24 may enhance tumor chemosensitivity to cisplatin.
25479732 Data show that Adenovirus-mediated interleukin 24 (Ad-IL-24) gene therapy suppresses growth of lung carcinoma cells SPC-A1 both in vitro and in vivo.
25236495 MDA-7/IL-24 inhibits Nrf2-mediated antioxidant response through activation of p38 pathway and inhibition of ERK pathway involved in cancer cell apoptosis.
25178435 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different
25091574 High expression of IL-24 was significantly correlated with second primary malignancy indicator in head and neck squamous cell carcinoma.
More...

AA Sequence

MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLW      1 - 70
EAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTL     71 - 140
ANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL        141 - 206
//

Text Mined References (123)

PMID Year Title
26977011 2016 IL24 and its Receptors Regulate Growth and Migration of Pancreatic Cancer Cells and Are Potential Biomarkers for IL24 Molecular Therapy.
26486636 2016 Modulation of CD4+ and CD8+ T-Cell Function by Interleukin 19 and Interleukin 24 During Filarial Infections.
26367324 2015 Interleukin-24 inhibits influenza A virus replication in vitro through induction of toll-like receptor 3 dependent apoptosis.
26168134 2014 IL-24 Induces Apoptosis via Upregulation of RNA-Activated Protein Kinase and Enhances Temozolomide-Induced Apoptosis in Glioma Cells.
26097559 2015 Targeting eradication of chronic myeloid leukemia using chimeric oncolytic adenovirus to drive IL-24 expression.
25778843 2015 Combination of IL-24 and cisplatin inhibits angiogenesis and lymphangiogenesis of cervical cancer xenografts in a nude mouse model by inhibiting VEGF, VEGF-C and PDGF-B.
25640309 2015 Systematic identification of molecular links between core and candidate genes in breast cancer.
25479732 2015 Adenovirus-mediated IL-24 confers radiosensitization to human lung adenocarcinoma in vitro and in vivo.
25236495 2014 MDA-7/IL-24 inhibits Nrf2-mediated antioxidant response through activation of p38 pathway and inhibition of ERK pathway involved in cancer cell apoptosis.
25178435 2015 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different contribution to systemic and joint inflammation.
More...