Property Summary

NCBI Gene PubMed Count 132
PubMed Score 795.19
PubTator Score 276.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer 1.200 3.4e-03
cutaneous lupus erythematosus 2.900 2.6e-04
cystic fibrosis 1.105 5.6e-03
interstitial cystitis 2.800 3.6e-02
osteosarcoma -3.412 3.5e-10
psoriasis 2.500 1.2e-74
tuberculosis -1.900 1.8e-06
ulcerative colitis 2.200 1.0e-02

Gene RIF (115)

AA Sequence

MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLW      1 - 70
EAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTL     71 - 140
ANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL        141 - 206
//

Text Mined References (133)

PMID Year Title