Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.71
PubTator Score 25.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.4e-08
osteosarcoma 7950 1.1e-06
adult high grade glioma 3801 1.1e-02
Disease Target Count Z-score Confidence
Liposarcoma 20 4.557 2.3
Malignant fibroxanthoma 7 3.858 1.9
Chondroma 15 3.527 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma 1.400 1.1e-02
osteosarcoma 2.459 1.1e-06
ovarian cancer -1.700 3.4e-08

Synonym

Accession Q12999 O00577 Q53X76 Tspan-31
Symbols SAS

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MVCGGFACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIAVAGLVGAVNH      1 - 70
HQVLLFFYMIILGLVFIFQFVISCSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQ     71 - 140
QDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMRFRNQKDPRANPSAFL    141 - 210
//

Text Mined References (16)

PMID Year Title