Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.14
PubTator Score 8.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
group 3 medulloblastoma 1.400 7.4e-05
intraductal papillary-mucinous carcinoma... 1.300 1.6e-03
intraductal papillary-mucinous neoplasm ... 1.900 2.6e-04
invasive ductal carcinoma 1.300 1.1e-02
lung cancer 1.400 1.8e-02
nasopharyngeal carcinoma 1.100 9.0e-04
osteosarcoma -2.263 4.6e-07
ovarian cancer 1.200 2.4e-04
pituitary cancer 1.100 2.8e-05

Gene RIF (5)

AA Sequence

MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKL      1 - 70
YIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSY     71 - 140
QIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRS    141 - 210
RDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAY    211 - 280
EQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYE    281 - 350
ESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDTRTRHHVYVTAALMEY    351 - 420
YCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLA    421 - 490
FESNIGDLASILKVEKRRFTAFKEEYEGKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLAAIIPD    491 - 560
PVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLLPPPICFQ    561 - 630
GPFVQVDELMEIFRRCKIPNTVEEAVRIITGGAPELAVEGNGPVESNAVLTKAVKRPNEDSDEDEEKGAV    631 - 700
VPPVHDIYRARQQKRIR                                                         701 - 717
//

Text Mined References (33)

PMID Year Title