Property Summary

NCBI Gene PubMed Count 128
Grant Count 111
R01 Count 78
Funding $17,945,615.81
PubMed Score 314.53
PubTator Score 187.04

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q12983 O14620 Q96GP0
Symbols NIP3

Gene

PDB

2J5D   2KA1   2KA2  

Gene RIF (100)

PMID Text
26416963 The findings of the present study reveal a novel survival pathway that functionally couples the unique glycolytic phenotype in cancer cells to hypoxia resistance via a PDK2-dependent mechanism that switches Bnip3 from cell death to survival.
26358776 Results suggest that changes in mitochondrial morphology and transmembrane potential, induced by mutant htt protein, are dependent and linked to BNip3 and not to Bax/Bak activation.
26323347 Hypoxia-induced autophagy contributes to the invasion of salivary adenoid cystic carcinoma through the HIF-1alpha/BNIP3 signaling pathway.
26253153 Bnip3 dual-functionality and crosstalk between mitophagy and apoptosis pathways is presented here.
26232272 BNIP3 deletion can be used as a prognostic marker of tumor progression to metastasis in human triple-negative breast cancer
26102349 phosphorylation of these C-terminal BNIP3 residues blocks cell death without preventing autophagy, providing evidence that the two functional roles of BNIP3 can be regulated independently
26012884 BNIP3 expression was found to be regulated by Sp3 in prostate cancer.
25891311 these findings revealed that silibinin induced autophagic cell death through ROS-dependent mitochondrial dysfunction and ATP depletion involving BNIP3 in MCF7 cells.
25769455 The data indicated that BNIP3 plays a vital role in the tumorigenesis of adenoid cystic carcinoma and could be a new target for gene therapy of adenoid cystic carcinoma.
25618603 our results bring the evidence of a mechanism that links apoptosis and ROS-induced BNIP3 expression in MG-63 cells with bacalein treatment and suggest that baicalein has a good potential as an anti-osteosarcoma drug.
More...

AA Sequence

MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRS      1 - 70
QTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRT     71 - 140
ATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF                    141 - 194
//

Text Mined References (132)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26416963 2015 PDK2-mediated alternative splicing switches Bnip3 from cell death to cell survival.
26358776 2015 Bcl-2/adenovirus E1B 19-kDa interacting protein (BNip3) has a key role in the mitochondrial dysfunction induced by mutant huntingtin.
26323347 2015 Hypoxia-induced autophagy contributes to the invasion of salivary adenoid cystic carcinoma through the HIF-1?/BNIP3 signaling pathway.
26253153 2015 Autophagy capacity and sub-mitochondrial heterogeneity shape Bnip3-induced mitophagy regulation of apoptosis.
26232272 2015 Mitophagy defects arising from BNip3 loss promote mammary tumor progression to metastasis.
26102349 2015 Phosphorylation of the BNIP3 C-Terminus Inhibits Mitochondrial Damage and Cell Death without Blocking Autophagy.
26012884 2015 Transcriptional regulation of BNIP3 by Sp3 in prostate cancer.
25891311 2015 Silibinin, a natural flavonoid, induces autophagy via ROS-dependent mitochondrial dysfunction and loss of ATP involving BNIP3 in human MCF7 breast cancer cells.
25769455 2015 Expression of BNIP3 and its correlations to hypoxia-induced autophagy and clinicopathological features in salivary adenoid cystic carcinoma.
More...