Property Summary

NCBI Gene PubMed Count 23
Grant Count 9
R01 Count 9
Funding $754,946.75
PubMed Score 32.42
PubTator Score 35.08

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
25472445 BNIP-2 is a kinesin-1 adapter involved in vesicular transportation in the cytoplasm and that association with cargos depends on interaction of the CRAL-TRIO domain with membrane phosphatidylserine.
25378581 BNIP-2 directly interacted with the motor and tail domains of KIF5B via its BCH domain.
21130087 Data imply that SIRT1 may mediate MPP(+)-induced cytotoxicity, possibly through the regulation of BNIP2.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20704564 Inhibition of BNIP-2 expression did not affect the susceptibility to NK cell-mediated killing.
20677014 Observational study of gene-disease association. (HuGE Navigator)
17961507 Our results suggest that the caspase-mediated cleavage of BNIP-2 and BNIP-XL could result in the release of the BCH domain or smaller fragments that are crucial for their proapoptotic activities.
15652341 BNIP-2 in vivo induces cell dynamics by recruiting Cdc42
12944407 BNIP-2 has a role in regulating cell dynamics with a novel Rho GTPase-activating protein, BPGAP1
12901880 BNIPL-2, a novel homologue of BNIP-2, interacts with Bcl-2 and Cdc42GAP in apoptosis.
More...

AA Sequence

MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVL      1 - 70
SDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDH     71 - 140
RVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVY    141 - 210
LNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAE    211 - 280
LAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ                                        281 - 314
//

Text Mined References (33)

PMID Year Title
25472445 2015 BNIP-2 binds phosphatidylserine, localizes to vesicles, and is transported by kinesin-1.
25416956 2014 A proteome-scale map of the human interactome network.
25378581 2015 KIF5B transports BNIP-2 to regulate p38 mitogen-activated protein kinase activation and myoblast differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21130087 2011 SIRT1 deficiency attenuates MPP+-induced apoptosis in dopaminergic cells.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20704564 2010 Identification of the BCL2/adenovirus E1B-19K protein-interacting protein 2 (BNIP-2) as a granzyme B target during human natural killer cell-mediated killing.
More...