Property Summary

NCBI Gene PubMed Count 23
PubMed Score 32.83
PubTator Score 35.08

Knowledge Summary


No data available


  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.400 7.2e-06
astrocytic glioma 1.100 1.7e-02
Astrocytoma, Pilocytic 1.300 2.0e-08
atypical teratoid / rhabdoid tumor 1.300 2.3e-06
Breast cancer 2.400 2.7e-02
ependymoma 1.300 4.4e-13
gastric carcinoma 1.100 5.8e-03
glioblastoma 1.400 1.6e-09
group 4 medulloblastoma 1.300 1.5e-05
intraductal papillary-mucinous adenoma (... 1.200 5.6e-04
intraductal papillary-mucinous carcinoma... 1.300 1.2e-03
intraductal papillary-mucinous neoplasm ... 1.600 2.3e-03
invasive ductal carcinoma -1.600 6.1e-05
non primary Sjogren syndrome sicca -1.200 1.6e-02
non-small cell lung cancer -1.058 2.6e-16
oligodendroglioma 1.100 3.0e-02
osteosarcoma -1.378 4.1e-03
ovarian cancer -2.500 1.2e-10
Pick disease 1.200 1.3e-04
pituitary cancer 1.100 2.1e-06
primitive neuroectodermal tumor 1.400 2.4e-04
tuberculosis and treatment for 6 months 1.300 8.5e-06
ulcerative colitis 1.100 5.5e-04


Accession Q12982 B4DS94
Symbols NIP2


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

AA Sequence

LAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ                                        281 - 314

Text Mined References (33)

PMID Year Title