1. Home
  2. Targets
  3. Vesicle transport protein SEC20

Tbio Vesicle transport protein SEC20

SNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER. Required for maintenance of ER network. Implicated in the suppression of cell death. May be involved in mitochondrial autophagy.

This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. In addition, this protein is involved in vesicle transport into the endoplasmic reticulum. Alternative splicing of this gene results in four protein products with identical N- and C-termini. [provided by RefSeq, Mar 2011]

 Comments

Property Summary

NCBI Gene PubMed Count 14
Grant Count 5
R01 Count 4
Funding $647,937.53
PubMed Score 18.66
PubTator Score 29.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Disease Z-score Confidence
Spindle cell hemangioma 16 3.757 1.9
Compartment syndrome 10 3.122 1.6
Stomach disease 4 2.0
group 3 medulloblastoma 2,254

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.100 0.002

Synonym

Accession Q12981 D3DQM3 D3DQM4 D3DQM5 D3DQM6 O75622 O75623 O75624 Q6K044 Q96FG4
Symbols NIP1
SEC20
TRG-8

Gene

BNIP1

 Grant Application (5)

 GO Function (1)

 GO Component (8)

 GO Process (7)

 Compartment GO Term (34)

See all...

Pathway (6)

 UniProt Keyword (15)

See all...

Gene RIF (6)

PMID Text
23896122 BNip1 functions as a downstream modulator of RNF186 to direct endoplasmic reticulum stress-associated apoptotic signaling.
22639046 three members of the BNIP family, BNIP1, BNIP3 and BNIP3L, are expressed in the developing brain with distinct brain region specificity
22020994 ER-specific BNIP1 plays an important role in mitochondrial dynamics by modulating the mitochondrial fission protein Drp1
21931693 Human BNIP1 colocalizes with RNF185 at mitochondria and is polyubiquitinated by RNF185 through K63-based ubiquitin linkage in vivo.
19064571 Observational study of gene-disease association. (HuGE Navigator)
15272311 soluble N-ethylmaleimide-sensitive factor attachment protein may suppress apoptosis by competing with antiapoptotic proteins for the BH3 domain of BNIP1

AA Sequence 

MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDK      1 - 70
ESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITE     71 - 140
SLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALA    141 - 210
LFLATVLYIVKKRLFPFL                                                        211 - 228
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23896122 2013 A novel RING finger E3 ligase RNF186 regulate ER stress-mediated apoptosis through interaction with BNip1.
22639046 2012 Differential expression of BNIP family members of BH3-only proteins during the development and after axotomy in the rat.
22306654 2012 Common variants near MBNL1 and NKX2-5 are associated with infantile hypertrophic pyloric stenosis.
22020994 2012 Endoplasmic reticulum-specific BH3-only protein BNIP1 induces mitochondrial fragmentation in a Bcl-2- and Drp1-dependent manner.
21931693 2011 RNF185, a novel mitochondrial ubiquitin E3 ligase, regulates autophagy through interaction with BNIP1.
21269460 2011 Initial characterization of the human central proteome.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...