Property Summary

NCBI Gene PubMed Count 14
PubMed Score 20.08
PubTator Score 29.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
group 3 medulloblastoma 4104 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Stomach disease 8 0.0 3.0
Disease Target Count Z-score Confidence
Spindle cell hemangioma 16 3.699 1.8
Compartment syndrome 11 3.011 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.9e-03

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDK      1 - 70
ESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITE     71 - 140
SLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALA    141 - 210
LFLATVLYIVKKRLFPFL                                                        211 - 228
//

Text Mined References (17)

PMID Year Title