Property Summary

NCBI Gene PubMed Count 20
PubMed Score 119.04
PubTator Score 13.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Epilepsy, Partial, with Variable Foci 3 0.0 0.0
Disease Target Count P-value
tuberculosis 2010 1.3e-06
osteosarcoma 7950 1.6e-04
psoriasis 6694 6.5e-04
lung cancer 4740 6.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 4.0
Disease Target Count
Sickle Cell Anemia 53

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.600 6.9e-03
osteosarcoma -2.308 1.6e-04
psoriasis -1.300 6.5e-04
tuberculosis 1.200 1.3e-06

Synonym

Accession Q12980 D3DU40 Q1W6H0 Q4TT56 Q92469
Symbols MARE
NPR3
HS-40
RMD11
CGTHBA
FFEVF3
C16orf35

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MRDNTSPISVILVSSGSRGNKLLFRYPFQRSQEHPASQTSKPRSRYAASNTGDHADEQDGDSRFSDVILA      1 - 70
TILATKSEMCGQKFELKIDNVRFVGHPTLLQHALGQISKTDPSPKREAPTMILFNVVFALRANADPSVIN     71 - 140
CLHNLSRRIATVLQHEERRCQYLTREAKLILALQDEVSAMADGNEGPQSPFHHILPKCKLARDLKEAYDS    141 - 210
LCTSGVVRLHINSWLEVSFCLPHKIHYAASSLIPPEAIERSLKAIRPYHALLLLSDEKSLLGELPIDCSP    211 - 280
ALVRVIKTTSAVKNLQQLAQDADLALLQVFQLAAHLVYWGKAIIIYPLCENNVYMLSPNASVCLYSPLAE    281 - 350
QFSHQFPSHDLPSVLAKFSLPVSLSEFRNPLAPAVQETQLIQMVVWMLQRRLLIQLHTYVCLMASPSEEE    351 - 420
PRPREDDVPFTARVGGRSLSTPNALSFGSPTSSDDMTLTSPSMDNSSAELLPSGDSPLNQRMTENLLASL    421 - 490
SEHERAAILSVPAAQNPEDLRMFARLLHYFRGRHHLEEIMYNENTRRSQLLMLFDKFRSVLVVTTHEDPV    491 - 560
IAVFQALLP                                                                 561 - 569
//

Text Mined References (21)

PMID Year Title