Property Summary

NCBI Gene PubMed Count 31
Grant Count 8
R01 Count 8
Funding $440,008.66
PubMed Score 206.65
PubTator Score 93.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.010
Waldenstrons macroglobulinemia 1.352 0.004
Multiple myeloma 1.431 0.001
esophageal adenocarcinoma 1.800 0.019
psoriasis -1.900 0.000
osteosarcoma 1.584 0.000
tuberculosis and treatment for 3 months 1.100 0.000
lung cancer -1.500 0.008
Breast cancer 2.600 0.034
lung adenocarcinoma 1.178 0.000
Pick disease 1.400 0.000
ovarian cancer 2.600 0.000
Down syndrome 1.400 0.001

Gene RIF (13)

PMID Text
25193986 Our findings highlight the important role of miR-29c in regulating CRC EMT via GSK-3b/b-catenin signaling by targeting GNA13 and PTP4A and provide new insights into the metastatic basis of colorectal cancer
23568563 PTP4A2 expression is correlated with overall survival in progestin receptor-positive breast carcinomas.
23362275 Results suggest that TRP32 maintains the reduced state of PRL and thus regulates the biological function of PRL.
22413991 Studies indicate that PRL-1 and PRL-2 and PRL-3 are oncogenes and belong to the few phosphatases that lead to the development of cancer.
21993571 PRL-2 plays an important role in lung cancer and can be a biomarker of lung cancer, substituting for the function of other PRLs.
21765462 Results suggest a model in which PRL-2 promotes cell migration and invasion through an ERK1/2-dependent signaling pathway.
20841483 Overexpression of the protein tyrosine phosphatase PRL-2 correlates with breast tumor formation and progression.
20226699 Mouse pre-B-cells transfected with human PRL-2 had higher growth responses to Epo or IL-3, shorter cell cycle, less Epo requirement for survival, more cell migration, less cell adhesion, change to an immature cell morphology, & more Bmi-1 expression.
17666324 PRL-2 can promote cell adhesion and invasion activity of human hepatocellular carcinoma cells.
17440740 Colonic adenocarcinoma cells have the ability to produce PTP4A1, PTP4a2, and PTP4A3, which may relate to the lymph node metastasis of colonic adenocarcinoma.
More...

AA Sequence

MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDG      1 - 70
APPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNS     71 - 140
KQLLYLEKYRPKMRLRFRDTNGHCCVQ                                               141 - 167
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25193986 2014 MiR-29c mediates epithelial-to-mesenchymal transition in human colorectal carcinoma metastasis via PTP4A and GNA13 regulation of ?-catenin signaling.
23568563 2013 Protein tyrosine phosphatase 4A2 expression predicts overall and disease-free survival of human breast cancer and is associated with estrogen and progestin receptor status.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362275 2013 Thioredoxin-related protein 32 (TRP32) specifically reduces oxidized phosphatase of regenerating liver (PRL).
22413991 2013 Molecular mechanisms of the PRL phosphatases.
21993571 2012 Altered expression of phosphatase of regenerating liver gene family in non-small cell lung cancer.
21765462 2012 Metastasis-associated phosphatase PRL-2 regulates tumor cell migration and invasion.
21269460 2011 Initial characterization of the human central proteome.
20841483 2010 Overexpression of the protein tyrosine phosphatase PRL-2 correlates with breast tumor formation and progression.
More...