Property Summary

NCBI Gene PubMed Count 40
Grant Count 65
R01 Count 58
Funding $9,400,313.99
PubMed Score 479.31
PubTator Score 88.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Multiple myeloma 1,327
lung cancer 4,466

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.038 0.007
lung cancer 1.300 0.003

Synonym

Accession Q12972 Q5TEJ2 Q5TEJ4 Q5TIF2 Q6PKF6 Q9UBH1 Q9UBZ0 NIPP-1
Symbols ARD1
ARD-1
NIPP1
NIPP-1
PRO2047

Gene

PDB

3V4Y  

Gene RIF (17)

PMID Text
25907536 Data suggest overexpression of NIPP1 in HeLa cells causes induction of genes of mesenchymal lineage with reduction in cell proliferation; thus, key dephosphorylation events may be involved in epithelial-mesenchymal transition or transdifferentiation.
22940584 The molecular basis by which NIPP1 directs PP1 substrate specificity in the nucleus.
22815811 PP1/NIPP1 is a novel molecular compass that controls directed cell migration.
22768081 PP1 interacts with Tat in part through the binding of Val(36) and Phe(38) of Tat to PP1, and Tat is involved in the nuclear and subnuclear targeting of PP1
21360054 PP1 interacts with Tat in part through the binding of Val(36) and Phe(38) of Tat to PP1, and Tat is involved in the nuclear and subnuclear targeting of PP1
21098020 PP1 interacts with Tat in part through the binding of Val(36) and Phe(38) of Tat to PP1, and Tat is involved in the nuclear and subnuclear targeting of PP1
19460752 Knockdown of protein phosphatase 1, regulatory subunit 8 (PPP1R8) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18842582 NIPP1 works as a molecular sensor for PP1 to recognize phosphorylated Sap155.
18253837 NMR structure of the NIPP1 FHA domain.
17804093 NIPP1 is present in a complex with EED and EZH2 in vivo and has distinct binding sites for these proteins.
More...

AA Sequence

MAAAANSGSSLPLFDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRV      1 - 70
HAALVYHKHLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD     71 - 140
EKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEII    141 - 210
NPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHG    211 - 280
IHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLL    281 - 350
I//

Text Mined References (47)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25907536 2015 Protein phosphatase PP1-NIPP1 activates mesenchymal genes in HeLa cells.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22940584 2012 The molecular basis for substrate specificity of the nuclear NIPP1:PP1 holoenzyme.
22815811 2012 A role for PP1/NIPP1 in steering migration of human cancer cells.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...