Property Summary

NCBI Gene PubMed Count 43
PubMed Score 500.25
PubTator Score 88.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 3.3e-03
Multiple myeloma 1332 6.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cataract 4 multiple types 14 4.512 2.3

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.300 3.3e-03
Multiple myeloma 1.038 6.7e-03

Gene RIF (18)

AA Sequence

MAAAANSGSSLPLFDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRV      1 - 70
HAALVYHKHLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD     71 - 140
EKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEII    141 - 210
NPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHG    211 - 280
IHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLL    281 - 350
I//

Text Mined References (50)

PMID Year Title