Property Summary

NCBI Gene PubMed Count 48
PubMed Score 101.32
PubTator Score 55.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Schizophrenia 503
Disease Target Count P-value
osteosarcoma 7933 6.90675177302601E-9
ovarian cancer 8492 4.33076369635507E-7
malignant mesothelioma 3163 1.39315401849615E-6
sonic hedgehog group medulloblastoma 1482 2.32422987881111E-6
Pick disease 1893 8.26217428926954E-6
tuberculosis and treatment for 6 months 686 4.03742442020215E-5
atypical teratoid / rhabdoid tumor 4369 7.55781876714564E-5
psoriasis 6685 6.84864527450219E-4
medulloblastoma, large-cell 6234 0.00361409831153422
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00480409806895133
non primary Sjogren syndrome sicca 840 0.0192898000635031
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Progressive multifocal leukoencephalopathy 24 3.618 1.8

Expression

Synonym

Accession Q12968 O75211 Q14516 Q99840 Q99841 Q99842 NF-ATc3
Symbols NFAT4
NFATX

Gene

PANTHER Protein Class (1)

PDB

2XRW   2XS0  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (33)

PMID Text
26527057 Data indicate that RNA interference of NFAT isoforms NFATc1, NFATc2, NFATc3 and NFATc4 regulate gene expression differentially in human retinal microvascular endothelial cells (HRMEC).
26374065 two NFAT isoforms (NFAT4 and NFAT1) have shifted band-pass windows for the same receptor in the GPCR signaling pathway
25818645 Results show that two protein isoforms NFAT1 and NFAT4 are both cytosolic and stimulated by the same Ca2+ messenger but require distinct subcellular Ca2+ signals for activity.
25728138 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
25422138 Suggest nuclear NF-AT3 and NF-AT4 participates in atrial structural remodeling, and that PICP and TGF-beta1 levels may be sensitive serum biomarkers to estimate atrial structural remodeling with atrial fibrillation.
25215946 NFATc3 interacted in a SUMO-dependent manner with Trim17, an E3 ubiquitin ligase necessary for neuronal apoptosis
24582564 Microvesicles from tumor cells transferred TrpC5 to endothelial cells, inducing the expression of P-glycoprotein by activation of the transcription factor NFATc3 (nuclear factor of activated T cells isoform c3).
23929433 AP-1 and NFAT4 complex promotes miR-23a expression.
23219532 The closely related transcription factors NFAT1 and NFAT4 possess distinct nuclear localization dynamics in response to cell stimulation.
22977251 Data indicate that NFATc3 undergoes rapid dephosphorylation and nuclear translocation that are essentially complete within 20 min, although NFATc4 remains phosphorylated and localized to the cytosol.
More...

AA Sequence

MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLTTPLCLPHHGLPSH      1 - 70
SSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREF     71 - 140
LERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDVDSELNEAAARFTLGSPLT    141 - 210
SPGGSPGGCPGEETWHQQYGLGHSLSPRQSPCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAE    211 - 280
VCYAGSLSPHHSPVPSPGHSPRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAI    281 - 350
LPGKLELCSDDQGSLSPARETSIDDGLGSQYPLKKDSCGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL    351 - 420
DWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQMFIGTADDRYL    421 - 490
RPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILKLRNSDIELRKGETDIGRK    491 - 560
NTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQELPHIEKYSINSCSVNGGHEMVVTGSNFLPESK    561 - 630
IIFLEKGQDGRPQWEVEGKIIREKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPV    631 - 700
LMKQEHREEIDLSSVPSLPVPHPAQTQRPSSDSGCSHDSVLSGQRSLICSIPQTYASMVTSSHLPQLQCR    701 - 770
DESVSKEQHMIPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSG    771 - 840
LVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVADQITGQPSSQL    841 - 910
QPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTASSPSPATRMHSGQHSTQAQS    911 - 980
TGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDREPNFATIGLQDITLDDVNEIIGRDMSQISVS    981 - 1050
QGAGVSRQAPLPSPESLDLGRSDGL                                                1051 - 1075
//

Text Mined References (49)

PMID Year Title
26527057 2015 NFAT isoforms play distinct roles in TNF?-induced retinal leukostasis.
26374065 2015 Band-pass processing in a GPCR signaling pathway selects for NFAT transcription factor activation.
25818645 2015 Distinct spatial Ca2+ signatures selectively activate different NFAT transcription factor isoforms.
25422138 2014 Increased expression of NF-AT3 and NF-AT4 in the atria correlates with procollagen I carboxyl terminal peptide and TGF-?1 levels in serum of patients with atrial fibrillation.
25215946 2015 Control of neuronal apoptosis by reciprocal regulation of NFATc3 and Trim17.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24582564 2014 Tumor endothelial expression of P-glycoprotein upon microvesicular transfer of TrpC5 derived from adriamycin-resistant breast cancer cells.
24330068 2014 Nuclear Raf-1 kinase regulates the CXCR5 promoter by associating with NFATc3 to drive retinoic acid-induced leukemic cell differentiation.
23929433 2014 miR-23a inhibits E-cadherin expression and is regulated by AP-1 and NFAT4 complex during Fas-induced EMT in gastrointestinal cancer.
23543060 2013 MicroRNA-26 governs profibrillatory inward-rectifier potassium current changes in atrial fibrillation.
More...