Property Summary

NCBI Gene PubMed Count 48
Grant Count 62
R01 Count 51
Funding $6,727,539.28
PubMed Score 101.32
PubTator Score 55.80

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q12968 O75211 Q14516 Q99840 Q99841 Q99842 NF-ATc3
Symbols NFAT4
NFATX

Gene

PANTHER Protein Class (1)

PDB

2XRW   2XS0  

 GWAS Trait (1)

Gene RIF (35)

PMID Text
26527057 Data indicate that RNA interference of NFAT isoforms NFATc1, NFATc2, NFATc3 and NFATc4 regulate gene expression differentially in human retinal microvascular endothelial cells (HRMEC).
26374065 two NFAT isoforms (NFAT4 and NFAT1) have shifted band-pass windows for the same receptor in the GPCR signaling pathway
25818645 Results show that two protein isoforms NFAT1 and NFAT4 are both cytosolic and stimulated by the same Ca2+ messenger but require distinct subcellular Ca2+ signals for activity.
25728138 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
25728138 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
25422138 Suggest nuclear NF-AT3 and NF-AT4 participates in atrial structural remodeling, and that PICP and TGF-beta1 levels may be sensitive serum biomarkers to estimate atrial structural remodeling with atrial fibrillation.
25215946 NFATc3 interacted in a SUMO-dependent manner with Trim17, an E3 ubiquitin ligase necessary for neuronal apoptosis
24582564 Microvesicles from tumor cells transferred TrpC5 to endothelial cells, inducing the expression of P-glycoprotein by activation of the transcription factor NFATc3 (nuclear factor of activated T cells isoform c3).
23929433 AP-1 and NFAT4 complex promotes miR-23a expression.
23219532 The closely related transcription factors NFAT1 and NFAT4 possess distinct nuclear localization dynamics in response to cell stimulation.
More...

AA Sequence

MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLTTPLCLPHHGLPSH      1 - 70
SSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREF     71 - 140
LERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDVDSELNEAAARFTLGSPLT    141 - 210
SPGGSPGGCPGEETWHQQYGLGHSLSPRQSPCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAE    211 - 280
VCYAGSLSPHHSPVPSPGHSPRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAI    281 - 350
LPGKLELCSDDQGSLSPARETSIDDGLGSQYPLKKDSCGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL    351 - 420
DWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQMFIGTADDRYL    421 - 490
RPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILKLRNSDIELRKGETDIGRK    491 - 560
NTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQELPHIEKYSINSCSVNGGHEMVVTGSNFLPESK    561 - 630
IIFLEKGQDGRPQWEVEGKIIREKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPV    631 - 700
LMKQEHREEIDLSSVPSLPVPHPAQTQRPSSDSGCSHDSVLSGQRSLICSIPQTYASMVTSSHLPQLQCR    701 - 770
DESVSKEQHMIPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSG    771 - 840
LVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVADQITGQPSSQL    841 - 910
QPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTASSPSPATRMHSGQHSTQAQS    911 - 980
TGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDREPNFATIGLQDITLDDVNEIIGRDMSQISVS    981 - 1050
QGAGVSRQAPLPSPESLDLGRSDGL                                                1051 - 1075
//

Text Mined References (49)

PMID Year Title
26527057 2015 NFAT isoforms play distinct roles in TNF?-induced retinal leukostasis.
26374065 2015 Band-pass processing in a GPCR signaling pathway selects for NFAT transcription factor activation.
25818645 2015 Distinct spatial Ca2+ signatures selectively activate different NFAT transcription factor isoforms.
25422138 2014 Increased expression of NF-AT3 and NF-AT4 in the atria correlates with procollagen I carboxyl terminal peptide and TGF-?1 levels in serum of patients with atrial fibrillation.
25215946 2015 Control of neuronal apoptosis by reciprocal regulation of NFATc3 and Trim17.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24582564 2014 Tumor endothelial expression of P-glycoprotein upon microvesicular transfer of TrpC5 derived from adriamycin-resistant breast cancer cells.
24330068 2014 Nuclear Raf-1 kinase regulates the CXCR5 promoter by associating with NFATc3 to drive retinoic acid-induced leukemic cell differentiation.
23929433 2014 miR-23a inhibits E-cadherin expression and is regulated by AP-1 and NFAT4 complex during Fas-induced EMT in gastrointestinal cancer.
23543060 2013 MicroRNA-26 governs profibrillatory inward-rectifier potassium current changes in atrial fibrillation.
More...