Property Summary

NCBI Gene PubMed Count 53
PubMed Score 110.95
PubTator Score 55.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 7.6e-05
malignant mesothelioma 1.300 1.4e-06
medulloblastoma 1.100 2.9e-05
medulloblastoma, large-cell 1.100 3.6e-03
non primary Sjogren syndrome sicca -1.200 1.9e-02
osteosarcoma 1.529 1.8e-03
ovarian cancer -1.300 4.3e-07
pancreatic ductal adenocarcinoma liver m... -1.211 4.8e-03
Pick disease 1.200 8.3e-06
psoriasis 1.100 6.8e-04
tuberculosis and treatment for 3 months 1.200 2.4e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (38)

AA Sequence

MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLTTPLCLPHHGLPSH      1 - 70
SSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREF     71 - 140
LERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDVDSELNEAAARFTLGSPLT    141 - 210
SPGGSPGGCPGEETWHQQYGLGHSLSPRQSPCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAE    211 - 280
VCYAGSLSPHHSPVPSPGHSPRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAI    281 - 350
LPGKLELCSDDQGSLSPARETSIDDGLGSQYPLKKDSCGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL    351 - 420
DWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQMFIGTADDRYL    421 - 490
RPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILKLRNSDIELRKGETDIGRK    491 - 560
NTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQELPHIEKYSINSCSVNGGHEMVVTGSNFLPESK    561 - 630
IIFLEKGQDGRPQWEVEGKIIREKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPV    631 - 700
LMKQEHREEIDLSSVPSLPVPHPAQTQRPSSDSGCSHDSVLSGQRSLICSIPQTYASMVTSSHLPQLQCR    701 - 770
DESVSKEQHMIPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSG    771 - 840
LVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVADQITGQPSSQL    841 - 910
QPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTASSPSPATRMHSGQHSTQAQS    911 - 980
TGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDREPNFATIGLQDITLDDVNEIIGRDMSQISVS    981 - 1050
QGAGVSRQAPLPSPESLDLGRSDGL                                                1051 - 1075
//

Text Mined References (54)

PMID Year Title