Property Summary

NCBI Gene PubMed Count 40
PubMed Score 683.62
PubTator Score 300.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 1.0e-03
ependymoma 1.100 2.2e-02
lung adenocarcinoma -1.200 9.7e-05
lung cancer -1.500 1.0e-03
malignant mesothelioma 1.200 4.9e-06
oligodendroglioma 1.200 6.8e-03
pancreatic ductal adenocarcinoma liver m... 1.411 4.2e-03
pituitary cancer -1.100 4.8e-04
primary Sjogren syndrome -1.100 5.0e-02
psoriasis -1.100 2.9e-03

 GWAS Trait (1)

Gene RIF (10)

AA Sequence

MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRPESSTQEIGEE      1 - 70
LINGVIYSISLRKVQLHHGGNKGQRWLGYENESALNLYETCKVRTVKAGTLEKLVEHLVPAFQGSDLSYV     71 - 140
TIFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSE    141 - 210
DFCQPPDFPCLKQLVAYVQLNMPGSDLERRAHLLLAQLEHSEPIEAEPEALSPVPALKPTPELELALTPA    211 - 280
RAPSPVPAPAPEPEPAPTPAPGSELEVAPAPAPELQQAPEPAVGLESAPAPALELEPAPEQDPAPSQTLE    281 - 350
LEPAPAPVPSLQPSWPSPVVAENGLSEEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDK    351 - 420
KGKEHLAPTIRATVTQFNSVANCVITTCLGNRSTKAPDRARVVEHWIEVARECRILKNFSSLYAILSALQ    421 - 490
SNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKETGII    491 - 560
QGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSACNNYSIAPDEQFGAWFRAV    561 - 630
ERLSETESYNLSCELEPPSESASNTLRTKKNTAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSS    631 - 700
GDIADALSVHSAGSSSSDVEEINISFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVA    701 - 770
ATRTHKRSVSGLCNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEE    771 - 840
EEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIA    841 - 910
KGIF                                                                      911 - 914
//

Text Mined References (43)

PMID Year Title