Property Summary

NCBI Gene PubMed Count 39
Grant Count 138
R01 Count 105
Funding $8,049,950.93
PubMed Score 667.17
PubTator Score 300.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
ependymoma 1.400 0.007
oligodendroglioma 1.200 0.007
cutaneous lupus erythematosus -1.200 0.001
psoriasis -1.100 0.003
pancreatic ductal adenocarcinoma liver m... 1.411 0.004
lung cancer -1.500 0.001
primary Sjogren syndrome -1.100 0.050
lung adenocarcinoma -1.200 0.000
pituitary cancer -1.100 0.000

Synonym

Gene

PDB

1RAX   2B3A   2RGF   3KH0  

Gene RIF (10)

PMID Text
22738401 Investigated is the role that electrostatic field differences caused by the charge reversal mutation Rap1A K31E play in determining the binding specificity of RalGDS to Rap1A versus Ras.
19801192 Studies provide models for Ras in association with Raf kinase, RalGDS and PI3Kalpha and PI3Kgamma.
18948269 RalGDS and RalA act downstream of Rheb and that RalA activation is a crucial step in nutrient-induced mTORC1 activation
18417737 overexpression of RalGDS promotes exocytosis of Weibel-Palade bodies from endothelial cells
17992125 results of screening suggest that RALGDS is not mutationally altered in cutaneous melanoma
17709381 These data extend understanding of the functional roles of the Ral pathway and begin to identify signaling pathways relevant for organ-specific metastasis.
16007223 Merlin can function as a tumor suppressor by inhibiting the RalGDS-mediated oncogenic signals.
15208305 RALGDS has a role in attenuating p53-independent DNA damage G2 checkpoint
12105416 identified Ral-GDS as a beta-arrestin-binding protein by yeast two-hybrid screening and co-immunoprecipitation from human polymorphonuclear neutrophilic leukocytes
11840339 involved in regulation of choline kinase activity by Ras proteins

AA Sequence

MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRPESSTQEIGEE      1 - 70
LINGVIYSISLRKVQLHHGGNKGQRWLGYENESALNLYETCKVRTVKAGTLEKLVEHLVPAFQGSDLSYV     71 - 140
TIFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSE    141 - 210
DFCQPPDFPCLKQLVAYVQLNMPGSDLERRAHLLLAQLEHSEPIEAEPEALSPVPALKPTPELELALTPA    211 - 280
RAPSPVPAPAPEPEPAPTPAPGSELEVAPAPAPELQQAPEPAVGLESAPAPALELEPAPEQDPAPSQTLE    281 - 350
LEPAPAPVPSLQPSWPSPVVAENGLSEEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDK    351 - 420
KGKEHLAPTIRATVTQFNSVANCVITTCLGNRSTKAPDRARVVEHWIEVARECRILKNFSSLYAILSALQ    421 - 490
SNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKETGII    491 - 560
QGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSACNNYSIAPDEQFGAWFRAV    561 - 630
ERLSETESYNLSCELEPPSESASNTLRTKKNTAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSS    631 - 700
GDIADALSVHSAGSSSSDVEEINISFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVA    701 - 770
ATRTHKRSVSGLCNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEE    771 - 840
EEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIA    841 - 910
KGIF                                                                      911 - 914
//

Text Mined References (42)

PMID Year Title
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
22738401 2012 Role of electrostatics in differential binding of RalGDS to Rap mutations E30D and K31E investigated by vibrational spectroscopy of thiocyanate probes.
22705156 2012 WNT-3a modulates platelet function by regulating small GTPase activity.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20936779 2010 A human MAP kinase interactome.
19801192 2009 Ras classical effectors: new tales from in silico complexes.
18948269 2008 RalA functions as an indispensable signal mediator for the nutrient-sensing system.
18417737 2008 Guanine exchange factor RalGDS mediates exocytosis of Weibel-Palade bodies from endothelial cells.
17992125 2007 No evidence of RALGDS mutations in cutaneous melanoma.
More...