Property Summary

NCBI Gene PubMed Count 21
Grant Count 18
R01 Count 9
Funding $2,883,420.85
PubMed Score 51.21
PubTator Score 20.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -3.400 0.000
psoriasis 1.200 0.000
osteosarcoma 1.124 0.000
posterior fossa group B ependymoma 1.700 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.500 0.001
pediatric high grade glioma 1.100 0.003
lung carcinoma -1.100 0.000

Gene RIF (9)

PMID Text
25739341 Coinheritance of COL4A5 and MYO1E mutations accentuate the severity of kidney disease.
24750828 MYO1E mutations are not a major cause of Chinese familial Steroid-resistant nephrotic syndrome.
23977349 Myo1e is a key component contributing to the functional integrity of podocytes.
21756023 MYO1E mutations are associated with childhood-onset, glucocorticoid-resistant focal segmental glomerulosclerosis.
21697813 Homozygosity mapping and exome sequencing in a consanguineous kindred identified MYO1E and NEIL1 as novel candidate genes for human autosomal recessive steroid-resistant nephrotic syndrome.
20860408 myo1e binds lipids through nonspecific electrostatic interactions rather than a stereospecific protein-phosphoinositide interaction.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17257598 Two proteins with prominent functions in endocytosis, synaptojanin-1 and dynamin, bind to the SH3 domain of human Myo1E.
11940582 The kinetic mechanism of Myo1e (human myosin-IC).

AA Sequence

MGSKGVYQYHWQSHNVKHSGVDDMVLLSKITENSIVENLKKRYMDDYIFTYIGSVLISVNPFKQMPYFGE      1 - 70
KEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSYISRVSGGGTKVQ     71 - 140
HVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSPGGEPDGGKISNFLLEKSRVVMRNPGERSFH    141 - 210
IFYQLIEGASAEQKHSLGITSMDYYYYLSLSGSYKVDDIDDRREFQETLHAMNVIGIFAEEQTLVLQIVA    211 - 280
GILHLGNISFKEVGNYAAVESEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACY    281 - 350
TRDALAKALHARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELT    351 - 420
LKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGIMSILDDVCATMHAVGEGADQTLLQKLQMQIG    421 - 490
SHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELPFIKSLFPENLQADKKGRPTT    491 - 560
AGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPRDWEESRVKHQVEYLGLKENIRVRRAGYAYRRIFQ    561 - 630
KFLQRYAILTKATWPSWQGEEKQGVLHLLQSVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYAR    631 - 700
VIQKSWRKFVARKKYVQMREEASDLLLNKKERRRNSINRNFIGDYIGMEEHPELQQFVGKREKIDFADTV    701 - 770
TKYDRRFKGVKRDLLLTPKCLYLIGREKVKQGPDKGLVKEVLKRKIEIERILSVSLSTMQDDIFILHEQE    771 - 840
YDSLLESVFKTEFLSLLAKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQFHQGFGDLAVLK    841 - 910
PSNKVLQVSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQNGVIRNQYVPYPHAPGS    911 - 980
QRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPESLDFLKVPDQGAAGVRRQTTSRPPPAGGRPKPQPKPK    981 - 1050
PQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGRLRGKQGLFPNNYVTKI               1051 - 1108
//

Text Mined References (27)

PMID Year Title
25739341 2015 Coinheritance of COL4A5 and MYO1E mutations accentuate the severity of kidney disease.
24750828 2014 [Mutational analysis of MYO1E in Chinese children with familial steroid-resistant nephrotic syndrome].
24047820 2013 Common variation contributes to the genetic architecture of social communication traits.
23977349 2013 Myo1e impairment results in actin reorganization, podocyte dysfunction, and proteinuria in zebrafish and cultured podocytes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
21756023 2011 MYO1E mutations and childhood familial focal segmental glomerulosclerosis.
21697813 2011 Exome sequencing identified MYO1E and NEIL1 as candidate genes for human autosomal recessive steroid-resistant nephrotic syndrome.
21458045 2011 A Genome-wide multidimensional RNAi screen reveals pathways controlling MHC class II antigen presentation.
21269460 2011 Initial characterization of the human central proteome.
More...