Property Summary

NCBI Gene PubMed Count 42
Grant Count 6
R01 Count 6
Funding $509,276.68
PubMed Score 13.39
PubTator Score 16.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.343 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.016
ovarian cancer 2.100 0.000
Gaucher disease type 1 1.100 0.022

Synonym

Accession Q12962 O00703 Q13175 Q6FH13
Symbols TAF2A
TAF2H
TAFII30

Gene

PANTHER Protein Class (1)

PDB

2F69   3M53   3M54   3M55   3M56   3M57   3M58   3M59   3M5A   4J7F   4J7I   4J83   4J8O   5EG2   4WV4  

Gene RIF (19)

PMID Text
25959397 Lysine oxidation of the transcription factor TAF10 by LOXL2 is a controlled protein modification and demonstrates a role for protein oxidation in regulating pluripotency genes.
25586196 the TAF2-TAF8-TAF10 complex demonstrates that there is a stepwise assembly pathway of nuclear holo-TFIID, regulated by nuclear import of preformed cytoplasmic submodules
23827503 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
23827503 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
22834489 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
20457598 The carboxyl-terminal domain of the largest subunit of RNA polymerase II (pol II) comprises multiple tandem repeats of a heptapeptide.
20106982 CDKN1C negatively regulates RNA polymerase II C-terminal domain phosphorylation in an E2F1-dependent manner
17599049 TAFII30 was required for optimal P4 promoter activity and for the repressive association of estrogen receptor.
15870280 novel role of three mammalian interacting partners in the nuclear localization of TAF10
15099517 TAF10 can be monomethylated by SET9-mediated methylation.
More...

AA Sequence

MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGE      1 - 70
PAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLN     71 - 140
RAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGIN    141 - 210
VKKPHYFT                                                                  211 - 218
//

Text Mined References (47)

PMID Year Title
25959397 2015 LOXL2 Oxidizes Methylated TAF10 and Controls TFIID-Dependent Genes during Neural Progenitor Differentiation.
25586196 2015 Cytoplasmic TAF2-TAF8-TAF10 complex provides evidence for nuclear holo-TFIID assembly from preformed submodules.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20457598 2010 The integrator complex recognizes a new double mark on the RNA polymerase II carboxyl-terminal domain.
20106982 2010 CDKN1C negatively regulates RNA polymerase II C-terminal domain phosphorylation in an E2F1-dependent manner.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18206972 2008 A TFTC/STAGA module mediates histone H2A and H2B deubiquitination, coactivates nuclear receptors, and counteracts heterochromatin silencing.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...