Property Summary

NCBI Gene PubMed Count 43
PubMed Score 15.22
PubTator Score 16.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Gaucher disease type 1 1.100 2.2e-02
intraductal papillary-mucinous neoplasm ... -1.100 1.6e-02
osteosarcoma -1.343 1.5e-05
ovarian cancer 2.100 1.6e-06

Gene RIF (18)

AA Sequence

MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGE      1 - 70
PAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLN     71 - 140
RAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGIN    141 - 210
VKKPHYFT                                                                  211 - 218
//

Text Mined References (48)

PMID Year Title