Property Summary

NCBI Gene PubMed Count 83
Grant Count 117
R01 Count 70
Funding $15,177,055.35
PubMed Score 146.73
PubTator Score 120.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
nephrosclerosis -1.094 0.005
gastric cancer 1.100 0.016
Chronic Lymphocytic Leukemia -1.033 0.006
malignant mesothelioma -1.400 0.000
astrocytic glioma -2.600 0.007
posterior fossa group A ependymoma -4.900 0.000
oligodendroglioma -2.300 0.002
psoriasis -3.200 0.000
glioblastoma -4.500 0.000
medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -3.500 0.000
primitive neuroectodermal tumor -2.100 0.044
Crohn's disease -1.225 0.033
acute quadriplegic myopathy 1.024 0.000
colon cancer -1.700 0.027
lung cancer -2.500 0.000
pediatric high grade glioma -4.000 0.000
pilocytic astrocytoma -2.500 0.000
lung adenocarcinoma -1.100 0.000
Breast cancer 1.100 0.015
spina bifida -1.343 0.037
Pick disease -1.200 0.026
ductal carcinoma in situ 1.600 0.021
invasive ductal carcinoma 1.900 0.033
ulcerative colitis -2.500 0.000
pituitary cancer 1.200 0.001
sarcoidosis -1.100 0.015
dermatomyositis 1.900 0.001

Synonym

Accession Q12955 B1AQT2 B4DIL1 E9PE32 Q13484 Q5CZH9 Q5VXD5 Q7Z3G4 Q9H0P5 ANK-3
Symbols MRT37
ANKYRIN-G

Gene

PANTHER Protein Class (1)

PDB

4O6X  

Gene RIF (64)

PMID Text
26574545 ankyrin-G associates with and inhibits the endocytosis of VE-cadherin cis dimers.
26227746 we investigated the association of CACNA1C and ANK3 with SZ using meta-analytic techniques.
26055424 Whole-exome sequencing in ASD patients from each family identified a second rare inherited genetic variant, affecting either the ANK3 genes encoding NLGN4X interacting proteins expressed in inhibitory or in excitatory synapses.
25998125 Phosphorylation of KCNQ2 and KCNQ3 anchor domains by protein kinase CK2 augments binding to AnkG.
25711502 ANK3 bipolar-risk polymorphisms are associated with hyperactivation in the ventral anterior cingulate cortex in bipolar disorder.
25616663 Kidney AE1 actually associates with epithelial ankyrin-G and renal ammonium transporter RhBG, which also binds ankyrin-G.
25311363 ANK3 rs10761482 showed a significant association with bipolar disorder
25307106 Data suggest that death domain of ankyrin G (ANK3-DD; located near C-terminus) exhibits C-terminal tail that curves back so that aromatic ring of a phenylalanine residue anchors flexible tail onto core domain; ANK3-DD exists as monomer in solution.
24914473 Study showed a significant association between LMAN2L and risk of both bipolar disorder and schizophrenia
24809399 Here, we show that ANK3 gene expression in blood is significantly increased in bipolar disorder and schizophrenia compared with healthy controls.
More...

AA Sequence

MAHAASQLKKNRDLEINAEEEPEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDYIKNGVDINIC      1 - 70
NQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNG     71 - 140
FTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAA    141 - 210
RKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGN    211 - 280
ANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCV    281 - 350
QLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL    351 - 420
KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGA    421 - 490
QVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSI    491 - 560
TTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN    561 - 630
GYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTP    631 - 700
LHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQA    701 - 770
AQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLKIVTEETMTTTTVTEKHKMNVPETM    771 - 840
NEVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGPQDLKELGDDSLPAEGYMGFSLGAR    841 - 910
SASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPI    911 - 980
HSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMG    981 - 1050
PAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKK   1051 - 1120
RICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVK   1121 - 1190
KILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDI   1191 - 1260
TGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESSLRC   1261 - 1330
FCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIK   1331 - 1400
IRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKETESDQDDEIEKTDRRQSFASLALRKRYS   1401 - 1470
YLTEPGMIERSTGATRSLPTTYSYKPFFSTRPYQSWTTAPITVPGPAKSGFTSLSSSSSNTPSASPLKSI   1471 - 1540
WSVSTPSPIKSTLGASTTSSVKSISDVASPIRSFRTMSSPIKTVVSQSPYNIQVSSGTLARAPAVTEATP   1541 - 1610
LKGLASNSTFSSRTSPVTTAGSLLERSSITMTPPASPKSNINMYSSSLPFKSIITSAAPLISSPLKSVVS   1611 - 1680
PVKSAVDVISSAKITMASSLSSPVKQMPGHAEVALVNGSISPLKYPSSSTLINGCKATATLQEKISSATN   1681 - 1750
SVSSVVSAATDTVEKVFSTTTAMPFSPLRSYVSAAPSAFQSLRTPSASALYTSLGSSISATTSSVTSSII   1751 - 1820
TVPVYSVVNVLPEPALKKLPDSNSFTKSAAALLSPIKTLTTETHPQPHFSRTSSPVKSSLFLAPSALKLS   1821 - 1890
TPSSLSSSQEILKDVAEMKEDLMRMTAILQTDVPEEKPFQPELPKEGRIDDEEPFKIVEKVKEDLVKVSE   1891 - 1960
ILKKDVCVDNKGSPKSPKSDKGHSPEDDWIEFSSEEIREARQQAAASQSPSLPERVQVKAKAASEKDYNL   1961 - 2030
TKVIDYLTNDIGSSSLTNLKYKFEDAKKDGEERQKRVLKPAIALQEHKLKMPPASMRTSTSEKELCKMAD   2031 - 2100
SFFGTDTILESPDDFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHEVPIPPVITETRTEVV   2101 - 2170
HVIRSYDPSAGDVPQTQPEEPVSPKPSPTFMELEPKPTTSSIKEKVKAFQMKASSEEDDHNRVLSKGMRV   2171 - 2240
KEETHITTTTRMVYHSPPGGEGASERIEETMSVHDIMKAFQSGRDPSKELAGLFEHKSAVSPDVHKSAAE   2241 - 2310
TSAQHAEKDNQMKPKLERIIEVHIEKGNQAEPTEVIIRETKKHPEKEMYVYQKDLSRGDINLKDFLPEKH   2311 - 2380
DAFPCSEEQGQQEEEELTAEESLPSYLESSRVNTPVSQEEDSRPSSAQLISDDSYKTLKLLSQHSIEYHD   2381 - 2450
DELSELRGESYRFAEKMLLSEKLDVSHSDTEESVTDHAGPPSSELQGSDKRSREKIATAPKKEILSKIYK   2451 - 2520
DVSENGVGKVSKDEHFDKVTVLHYSGNVSSPKHAMWMRFTEDRLDRGREKLIYEDRVDRTVKEAEEKLTE   2521 - 2590
VSQFFRDKTEKLNDELQSPEKKARPKNGKEYSSQSPTSSSPEKVLLTELLASNDEWVKARQHGPDGQGFP   2591 - 2660
KAEEKAPSLPSSPEKMVLSQQTEDSKSTVEAKGSISQSKAPDGPQSGFQLKQSKLSSIRLKFEQGTHAKS   2661 - 2730
KDMSQEDRKSDGQSRIPVKKIQESKLPVYQVFAREKQQKAIDLPDESVSVQKDFMVLKTKDEHAQSNEIV   2731 - 2800
VNDSGSDNVKKQRTEMSSKAMPDSFSEQQAKDLACHITSDLATRGPWDKKVFRTWESSGATNNKSQKEKL   2801 - 2870
SHVLVHDVRENHIGHPESKSVDQKNEFMSVTERERKLLTNGSLSEIKEMTVKSPSKKVLYREYVVKEGDH   2871 - 2940
PGGLLDQPSRRSESSAVSHIPVRVADERRMLSSNIPDGFCEQSAFPKHELSQKLSQSSMSKETVETQHFN   2941 - 3010
SIEDEKVTYSEISKVSKHQSYVGLCPPLEETETSPTKSPDSLEFSPGKESPSSDVFDHSPIDGLEKLAPL   3011 - 3080
AQTEGGKEIKTLPVYVSFVQVGKQYEKEIQQGGVKKIISQECKTVQETRGTFYTTRQQKQPPSPQGSPED   3081 - 3150
DTLEQVSFLDSSGKSPLTPETPSSEEVSYEFTSKTPDSLIAYIPGKPSPIPEVSEESEEEEQAKSTSLKQ   3151 - 3220
TTVEETAVEREMPNDVSKDSNQRPKNNRVAYIEFPPPPPLDADQIESDKKHHYLPEKEVDMIEVNLQDEH   3221 - 3290
DKYQLAEPVIRVQPPSPVPPGADVSDSSDDESIYQPVPVKKYTFKLKEVDDEQKEKPKASAEKASNQKEL   3291 - 3360
ESNGSGKDNEFGLGLDSPQNEIAQNGNNDQSITECSIATTAEFSHDTDATEIDSLDGYDLQDEDDGLTES   3361 - 3430
DSKLPIQAMEIKKDIWNTEGILKPADRSFSQSKLEVIEEEGKVGPDEDKPPSKSSSSEKTPDKTDQKSGA   3431 - 3500
QFFTLEGRHPDRSVFPDTYFSYKVDEEFATPFKTVATKGLDFDPWSNNRGDDEVFDSKSREDETKPFGLA   3501 - 3570
VEDRSPATTPDTTPARTPTDESTPTSEPNPFPFHEGKMFEMTRSGAIDMSKRDFVEERLQFFQIGEHTSE   3571 - 3640
GKSGDQGEGDKSMVTATPQPQSGDTTVETNLERNVETPTVEPNPSIPTSGECQEGTSSSGSLEKSAAATN   3641 - 3710
TSKVDPKLRTPIKMGISASTMTMKKEGPGEITDKIEAVMTSCQGLENETITMISNTANSQMGVRPHEKHD   3711 - 3780
FQKDNFNNNNNLDSSTIQTDNIMSNIVLTEHSAPTCTTEKDNPVKVSSGKKTGVLQGHCVRDKQKVLGEQ   3781 - 3850
QKTKELIGIRQKSKLPIKATSPKDTFPPNHMSNTKASKMKQVSQSEKTKALTTSSCVDVKSRIPVKNTHR   3851 - 3920
DNIIAVRKACATQKQGQPEKGKAKQLPSKLPVKVRSTCVTTTTTTATTTTTTTTTTTTSCTVKVRKSQLK   3921 - 3990
EVCKHSIEYFKGISGETLKLVDRLSEEEKKMQSELSDEEESTSRNTSLSETSRGGQPSVTTKSARDKKTE   3991 - 4060
AAPLKSKSEKAGSEKRSSRRTGPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSL   4061 - 4130
ISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGW   4131 - 4200
QNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHTEITPEAKTKSYFPES   4201 - 4270
QNDVGKQSTKETLKPKIHGSGHVEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPR   4271 - 4340
LSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKSHS                                    4341 - 4377
//

Text Mined References (91)

PMID Year Title
26574545 2016 Ankyrin-G Inhibits Endocytosis of Cadherin Dimers.
26227746 2015 Genetic analysis of SNPs in CACNA1C and ANK3 gene with schizophrenia: A comprehensive meta-analysis.
26055424 2016 GABA/Glutamate synaptic pathways targeted by integrative genomic and electrophysiological explorations distinguish autism from intellectual disability.
25998125 2015 An Ankyrin-G N-terminal Gate and Protein Kinase CK2 Dually Regulate Binding of Voltage-gated Sodium and KCNQ2/3 Potassium Channels.
25711502 2015 The effect of ANK3 bipolar-risk polymorphisms on the working memory circuitry differs between loci and according to risk-status for bipolar disorder.
25616663 2015 Evidence of a structural and functional ammonium transporter RhBG·anion exchanger 1·ankyrin-G complex in kidney epithelial cells.
25311363 2015 Calcium-dependent intracellular signal pathways in primary cultured adipocytes and ANK3 gene variation in patients with bipolar disorder and healthy controls.
25307106 2014 Crystal structure of human Ankyrin G death domain.
24914473 2014 Genetic association of LMAN2L gene in schizophrenia and bipolar disorder and its interaction with ANK3 gene polymorphism.
24809399 2014 ANK3 gene expression in bipolar disorder and schizophrenia.
More...