Property Summary

NCBI Gene PubMed Count 19
Grant Count 32
R01 Count 21
Funding $2,880,396.66
PubMed Score 26.85
PubTator Score 13.66

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26062977 the downregulation of FOXL1 expression was associated with osteosarcoma cell growth. Restoration of FOXL1 gene expression by gene therapy may have a therapeutic potential for patients with osteosarcoma
25010679 dysregulated FOXL1 is involved in tumorigenesis and progression of gallbladder cancer.
24427331 results suggest that Foxl1 plays an inhibitory role in renal tumor progression.
23801748 Lower FOXL1 expression is correlated with metastasis and advanced pathologic stage of pancreatic cancer.
21536545 FUS-CREB3L2/L1-positive sarcomas show a specific gene expression profile with upregulation of CD24 and FOXL1.
21457232 two novel de novo mutations in rare patients inherited gene variants in FOXL1.
20198651 Observational study of gene-disease association. (HuGE Navigator)
18564921 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSHLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPYSYIALIAMAIQDAPEQRV      1 - 70
TLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRR     71 - 140
RKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPG    141 - 210
TASPNEDAGDAAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDSILAGKQGQKPPSGDE    211 - 280
LLGGAKPGPGGRLGASLLAASSSLRPPFNASLMLDPHVQGGFYQLGIPFLSYFPLQVPDTVLHFQ         281 - 345
//

Text Mined References (20)

PMID Year Title
26062977 2015 Inhibitory effects of forkhead box L1 gene on osteosarcoma growth through the induction of cell cycle arrest and apoptosis.
25010679 2014 Forkhead box L1 is frequently downregulated in gallbladder cancer and inhibits cell growth through apoptosis induction by mitochondrial dysfunction.
24430505 2014 Genetic determinants of heel bone properties: genome-wide association meta-analysis and replication in the GEFOS/GENOMOS consortium.
24427331 2014 Foxl1 inhibits tumor invasion and predicts outcome in human renal cancer.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
23801748 2013 FOXL1, a novel candidate tumor suppressor, inhibits tumor aggressiveness and predicts outcome in human pancreatic cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21536545 2011 FUS-CREB3L2/L1-positive sarcomas show a specific gene expression profile with upregulation of CD24 and FOXL1.
21457232 2012 Identification of de novo mutations and rare variants in hypoplastic left heart syndrome.
More...