Property Summary

NCBI Gene PubMed Count 20
PubMed Score 26.71
PubTator Score 13.66

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q12952 Q17RR1 Q9H242
Symbols FKH6
FKHL11
FREAC7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

AA Sequence

MSHLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPYSYIALIAMAIQDAPEQRV      1 - 70
TLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRR     71 - 140
RKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPG    141 - 210
TASPNEDAGDAAQGAAAVAVGQAARTGDGPGSPLRPASRSSPKSSDKSKSFSIDSILAGKQGQKPPSGDE    211 - 280
LLGGAKPGPGGRLGASLLAASSSLRPPFNASLMLDPHVQGGFYQLGIPFLSYFPLQVPDTVLHFQ         281 - 345
//

Text Mined References (21)

PMID Year Title