Property Summary

NCBI Gene PubMed Count 16
Grant Count 50
R01 Count 30
Funding $12,811,300.34
PubMed Score 154.17
PubTator Score 15.60

Knowledge Summary

Patent

No data available

Gene RIF (7)

PMID Text
23965030 We found no evidence for a significant association between mutations of KCNJ10 and FOXI1 with SLC26A4 in Pendred syndrome/enlarged vestibular aqueducts.
22412181 No FOXI1 mutations were present in bilateral deafness patients with inner ear malformation.
20621367 SLC26A4, FOXI1 and KCNJ10 are not major determinants in unilateral deafness and enlarged vestibular aqueduct
20621367 Observational study of gene-disease association. (HuGE Navigator)
19214237 Data suggestthat Foxi1 is necessary for expression of at least four subunits in three different epithelia and most likely is a major determinant for proper assembly of a functional vacuolar H(+)-ATPase complex at these locations.
18564921 Observational study of gene-disease association. (HuGE Navigator)
12695546 C/EBP alpha and HNF-3 gamma cooperatively regulate CYP3A4 expression in hepatic cells by a mechanism that probably involves chromatin remodeling.

AA Sequence

MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTM      1 - 70
TPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAP     71 - 140
DKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNG    141 - 210
NFRRKRKRKSDVSSSTASLALEKTESSLPVDSPKTTEPQDILDGASPGGTTSSPEKRPSPPPSGAPCLNS    211 - 280
FLSSMTAYVSGGSPTSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGG    281 - 350
SVLSQFSPHFYNSVNTSGVLYPREGTEV                                              351 - 378
//

Text Mined References (16)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23965030 2013 Lack of significant association between mutations of KCNJ10 or FOXI1 and SLC26A4 mutations in Pendred syndrome/enlarged vestibular aqueducts.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22412181 2012 Screening of SLC26A4, FOXI1, KCNJ10, and GJB2 in bilateral deafness patients with inner ear malformation.
20809947 2010 African signatures of recent positive selection in human FOXI1.
20621367 2010 Screening of SLC26A4, FOXI1 and KCNJ10 genes in unilateral hearing impairment with ipsilateral enlarged vestibular aqueduct.
19214237 2009 The forkhead transcription factor Foxi1 is a master regulator of vacuolar H-ATPase proton pump subunits in the inner ear, kidney and epididymis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18564921 2008 Candidate gene analysis in primary lymphedema.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...