Property Summary

NCBI Gene PubMed Count 17
PubMed Score 26.50
PubTator Score 15.60

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

AA Sequence

MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTM      1 - 70
TPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAP     71 - 140
DKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNG    141 - 210
NFRRKRKRKSDVSSSTASLALEKTESSLPVDSPKTTEPQDILDGASPGGTTSSPEKRPSPPPSGAPCLNS    211 - 280
FLSSMTAYVSGGSPTSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGG    281 - 350
SVLSQFSPHFYNSVNTSGVLYPREGTEV                                              351 - 378
//

Text Mined References (17)

PMID Year Title