Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.01
PubTator Score 9.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MNLPRAERLRSTPQRSLRDSDGEDGKIDVLGEEEDEDEEEAASQQFLEQSLQPGLQVARWGGVALPREHI      1 - 70
EGGGGPSDPSEFGTEFRAPPRSAAASEDARQPAKPPSSYIALITMAILQSPHKRLTLSGICAFISDRFPY     71 - 140
YRRKFPAWQNSIRHNLSLNDCFVKIPREPGRPGKGNYWSLDPASQDMFDNGSFLRRRKRFQRHQPTPGAH    141 - 210
LPHPFPLPAAHAALHNPRPGPLLGAPAPPQPVPGAYPNTGPGRRPYALLHPHPPRYLLLSAPAYAGAPKK    211 - 280
AEGADLATPAPFPCCSPHLVLSLGRRARVWRRHREADASLSALRVSCKGSGERVQGLRRVCPRPRGATAP    281 - 350
CSSDRQACRTILQQQQRHQEEDCANGCAPTKGAVLGGHLSAASALLRYQAVAEGSGLTSLAAPLGGEGTS    351 - 420
PVFLVSPTPSSLAESAGPS                                                       421 - 439
//

Text Mined References (17)

PMID Year Title