Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.51
PubTator Score 9.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
22876580 FOXd4 encodes forkhead box D4 protein.
17273782 The W148R mutation disrupts an extremely highly conserved tryptophan residue in the forkhead domain of FOXD4, possibly resulting in reduced DNA binding capacity and altered transcriptional activity.

AA Sequence

MNLPRAERLRSTPQRSLRDSDGEDGKIDVLGEEEDEDEEEAASQQFLEQSLQPGLQVARWGGVALPREHI      1 - 70
EGGGGPSDPSEFGTEFRAPPRSAAASEDARQPAKPPSSYIALITMAILQSPHKRLTLSGICAFISDRFPY     71 - 140
YRRKFPAWQNSIRHNLSLNDCFVKIPREPGRPGKGNYWSLDPASQDMFDNGSFLRRRKRFQRHQPTPGAH    141 - 210
LPHPFPLPAAHAALHNPRPGPLLGAPAPPQPVPGAYPNTGPGRRPYALLHPHPPRYLLLSAPAYAGAPKK    211 - 280
AEGADLATPAPFPCCSPHLVLSLGRRARVWRRHREADASLSALRVSCKGSGERVQGLRRVCPRPRGATAP    281 - 350
CSSDRQACRTILQQQQRHQEEDCANGCAPTKGAVLGGHLSAASALLRYQAVAEGSGLTSLAAPLGGEGTS    351 - 420
PVFLVSPTPSSLAESAGPS                                                       421 - 439
//

Text Mined References (17)

PMID Year Title
22876580 2012 Pure distal 9p deletion in a female infant with cerebral palsy.
21948691 2011 Maternally inherited partial monosomy 9p (pter???p24.1) and partial trisomy 20p (pter???p12.1) characterized by microarray comparative genomic hybridization.
21482378 2011 Inv dup del(9p): prenatal diagnosis and molecular cytogenetic characterization by fluorescence in situ hybridization and array comparative genomic hybridization.
20650821 2010 Update of human and mouse forkhead box (FOX) gene families.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17273782 2007 A W148R mutation in the human FOXD4 gene segregating with dilated cardiomyopathy, obsessive-compulsive disorder, and suicidality.
15492844 2004 Human FOX gene family (Review).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15233989 2004 Diverse fates of paralogs following segmental duplication of telomeric genes.
15164053 2004 DNA sequence and analysis of human chromosome 9.
More...