Property Summary

NCBI Gene PubMed Count 130
PubMed Score 201.79
PubTator Score 163.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Peters anomaly 16 4.045 2.0
Disease Target Count Z-score Confidence
Corneal disease 31 0.0 4.0

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.500 7.5e-03
Alzheimer's disease 1.100 4.4e-02
atypical teratoid/rhabdoid tumor -1.400 4.8e-03
Breast cancer -3.000 8.4e-07
breast carcinoma -2.000 2.4e-05
cystic fibrosis -1.479 1.1e-05
gastric carcinoma 2.200 4.8e-02
invasive ductal carcinoma -1.154 1.2e-02
lung adenocarcinoma 1.300 1.1e-03
medulloblastoma, large-cell -1.900 2.8e-04
osteosarcoma -2.734 5.5e-06
pancreatic cancer 1.200 4.6e-04
Pick disease 1.700 1.6e-02
pituitary cancer -1.300 3.5e-03
psoriasis -1.200 1.8e-07
spina bifida -2.323 3.6e-02

 GWAS Trait (1)

Gene RIF (107)

AA Sequence

MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQ      1 - 70
PQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVP     71 - 140
RDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKDRLHLKEPPPPGRQPPPAPPEQAD    141 - 210
GNAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPKIESPDSSSSSLSSGSSPPGSLPSA    211 - 280
RPLSLDGADSAPPPPAPSAPPPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLAL    281 - 350
GAYSPGQSSLYSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPGGAG    351 - 420
GSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAA    421 - 490
AAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF           491 - 553
//

Text Mined References (140)

PMID Year Title