Property Summary

NCBI Gene PubMed Count 110
Grant Count 189
R01 Count 96
Funding $26,719,931.09
PubMed Score 176.01
PubTator Score 163.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -2.734 0.000
cystic fibrosis -1.479 0.000
medulloblastoma, large-cell -1.900 0.000
pancreatic cancer 1.200 0.000
breast carcinoma -2.000 0.000
adult high grade glioma -1.500 0.007
atypical teratoid/rhabdoid tumor -1.400 0.005
lung adenocarcinoma 1.300 0.001
invasive ductal carcinoma -1.900 0.017
Breast cancer -3.000 0.000
spina bifida -2.323 0.036
Alzheimer's disease 1.100 0.044
Pick disease 1.700 0.016
gastric carcinoma 2.200 0.048
pituitary cancer -1.300 0.004

Synonym

Accession Q12948 Q86UP7 Q9BYM1 Q9NUE5 Q9UDD0 Q9UP06
Symbols ARA
IGDA
IHG1
FKHL7
IRID1
RIEG3
FREAC3
FREAC-3

Gene

Gene RIF (89)

PMID Text
26752265 A meta-analysis of the top SNPs identified three new associated loci in primary open angle glaucoma--TXNRD2, ATXN2, and FOXC1
26643481 These data suggest that deregulation of FOXC1 or its downstream genes play a major role in the pathogenesis of coarctation of the aorta in humans.
26585487 These findings suggest that miR-4792 functions as a tumor suppressor in NPC development and progression by targeting FOXC1.
26565916 FOXC1 directly binds Gli2 and potentiates Gli2 DNA-binding activity.
26382291 Disruptions of enhancers near FOXC1 and GMDS may influence brain development.
26065367 In HCC cell lines, IL8 activates expression of FOXC1 via the phosphoinositide 3-kinase signaling to AKT and hypoxia-inducible factor 1alpha. FOXC1 expression leads to transactivation of CXCR1 and CCL2, promoting inflammation and invasivion/metastasis.
26049754 Foxc1 is essential for progenitor cell development and maintenance of bone marrow niches for these cells upregulating CXCL12 and SCF expression and inhibiting of adipogenic processes in cell progenitors. (Review)
26041837 FOXC1 assay (IHC & qRT-PCR) accurately identified basal-like breast cancer (BLBC) in FFPE samples. FOXC1 expression also predicted the development of brain metastasis.
25875420 Our data indicate that miR-138-5p may play an important role in regulating pancreatic cancer cell growth, possibly through targeting FOXC1
25809640 This study shows that hsa-miR548-l regulates FOXC1 translation, contributing to better understand the fine regulation of the biological function of this transcription factor.
More...

AA Sequence

MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQ      1 - 70
PQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVP     71 - 140
RDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKDRLHLKEPPPPGRQPPPAPPEQAD    141 - 210
GNAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPKIESPDSSSSSLSSGSSPPGSLPSA    211 - 280
RPLSLDGADSAPPPPAPSAPPPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLAL    281 - 350
GAYSPGQSSLYSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPGGAG    351 - 420
GSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAA    421 - 490
AAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF           491 - 553
//

Text Mined References (119)

PMID Year Title
26752265 2016 Genome-wide association analysis identifies TXNRD2, ATXN2 and FOXC1 as susceptibility loci for primary open-angle glaucoma.
26643481 2016 Search for Rare Copy-Number Variants in Congenital Heart Defects Identifies Novel Candidate Genes and a Potential Role for FOXC1 in Patients With Coarctation of the Aorta.
26585487 2015 miR-4792 inhibits epithelial-mesenchymal transition and invasion in nasopharyngeal carcinoma by targeting FOXC1.
26565916 2015 FOXC1 Activates Smoothened-Independent Hedgehog Signaling in Basal-like Breast Cancer.
26382291 2016 Disruptions in a cluster of computationally identified enhancers near FOXC1 and GMDS may influence brain development.
26065367 2015 Interleukin-8 Induces Expression of FOXC1 to Promote Transactivation of CXCR1 and CCL2 in Hepatocellular Carcinoma Cell Lines and Formation of Metastases in Mice.
26049754 2015 The critical and specific transcriptional regulator of the microenvironmental niche for hematopoietic stem and progenitor cells.
26041837 2015 Diagnosis of Basal-Like Breast Cancer Using a FOXC1-Based Assay.
25875420 2015 MicroRNA-138-5p regulates pancreatic cancer cell growth through targeting FOXC1.
25809640 2015 The Role of hsa-miR-548l Dysregulation as a Putative Modifier Factor for Glaucoma-Associated FOXC1 Mutations.
More...