Property Summary

NCBI Gene PubMed Count 19
Grant Count 11
R01 Count 7
Funding $1,038,782.75
PubMed Score 24.71
PubTator Score 18.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
osteosarcoma 1.571 0.028
cystic fibrosis 2.668 0.000
non-small cell lung cancer -1.016 0.000
lung cancer -1.900 0.000
colon cancer -2.800 0.001
sonic hedgehog group medulloblastoma 1.700 0.003
lung adenocarcinoma -1.500 0.000
ovarian cancer 1.100 0.000

Gene RIF (11)

PMID Text
26278207 results provided statistical evidence of linkage and association between FOXF2 and nonsyndromic cleft lip with or without cleft palate.
26120030 Foxf2 inactivation in adults resulted in blood-brain barrier breakdown, endothelial thickening, and increased trans-endothelial vesicular transport
26070560 Subtype-specific expression and function of FOXF2 in breast cancer cells are regulated through the combined effects of DNA methylation and SP1 transcriptional regulation.
25824262 Loss of FOXF2 Expression is associated with Hepatocellular Carcinoma.
25798833 The miR-200 family and the miR-183~96~182 cluster target Foxf2 to inhibit invasion and metastasis in lung cancers.
25738520 MiR-182-induced downregulation of FoxF2.
23620774 decreased FOXF2 expression indicates the early-onset metastasis and poor prognosis for patients with histological grade II and triple-negative breast cancer.
23383207 MicroRNA-182-5p promotes cell invasion and proliferation by down regulating FOXF2, RECK and MTSS1 genes in human prostate cancer.
20634891 Observational study of gene-disease association. (HuGE Navigator)
19562724 The distinct expression pattern of FOXF2 in the prostate, its effect on expression of signaling, and its opposing role in the TGFbeta3 pathway, suggests a role for FOXF2 in prostate homeostasis and stroma-epithelial interactions
More...

AA Sequence

MTTEGGPPPAPLRRACSPVPGALQAALMSPPPAAAAAAAAAPETTSSSSSSSSASCASSSSSSNSASAPS      1 - 70
AACKSAGGGGAGAGSGGAKKASSGLRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGA     71 - 140
YQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYHRV    141 - 210
VSGLGFGASLLPQGFDFQAPPSAPLGCHSQGGYGGLDMMPAGYDAGAGAPSHAHPHHHHHHHVPHMSPNP    211 - 280
GSTYMASCPVPAGPGGVGAAGGGGGGDYGPDSSSSPVPSSPAMASAIECHSPYTSPAAHWSSPGASPYLK    281 - 350
QPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFH    351 - 420
PSASGSYYHHHHQSVCQDIKPCVM                                                  421 - 444
//

Text Mined References (20)

PMID Year Title
26278207 2015 Novel evidence of association with nonsyndromic cleft lip with or without cleft palate was shown for single nucleotide polymorphisms in FOXF2 gene in an Asian population.
26120030 2015 Foxf2 Is Required for Brain Pericyte Differentiation and Development and Maintenance of the Blood-Brain Barrier.
26070560 2015 DNA Methylation Affects the SP1-regulated Transcription of FOXF2 in Breast Cancer Cells.
25824262 2016 Loss of FOXF2 Expression Predicts Poor Prognosis in Hepatocellular Carcinoma Patients.
25798833 2016 The miR-200 family and the miR-183~96~182 cluster target Foxf2 to inhibit invasion and metastasis in lung cancers.
25738520 2015 miR-182 promotes cell growth and invasion by targeting forkhead box F2 transcription factor in colorectal cancer.
24662972 2014 Genome-wide interaction study of smoking and bladder cancer risk.
23620774 2013 Decreased FOXF2 mRNA expression indicates early-onset metastasis and poor prognosis for breast cancer patients with histological grade II tumor.
23383207 2013 MicroRNA-182-5p promotes cell invasion and proliferation by down regulating FOXF2, RECK and MTSS1 genes in human prostate cancer.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
More...