Property Summary

NCBI Gene PubMed Count 43
Grant Count 39
R01 Count 32
Funding $3,575,096.22
PubMed Score 90.60
PubTator Score 56.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (30)

PMID Text
27071622 Point mutations of FOXF1 gene is associated with alveolar capillary dysplasia.
26908052 Results show that FoxF1 increases invasiveness of breast cancer cells by upregulating LOX.
26383589 we provide supportive evidence that genetic variants at FOXP1, BARX1, and FOXF1 confer risk for the development of EAC.
26294094 Targeted Resequencing of 29 Candidate Genes and Mouse Expression Studies Implicate ZIC3 and FOXF1 in Human VATER/VACTERL Association
26293303 FOXF1 inhibits hematopoietic lineage commitment during early mesoderm specification.
25472632 Data indicate that constitutional duplication of FOXF1 in humans is not associated with any pediatric lung abnormalities.
25260753 FOXF1 was induced by the antifibrotic mediator Prostaglandin E2 and repressed by the profibrotic cytokine TGF-beta1, and FOXF1 repressed cell growth and collagen-1 expression in normal lung fibroblasts, consistent with participation in antifibrotic pathways.
25237908 FOXF1 behaved not only as a reprogramming regulator that mediates stemness but also as a putative tumor suppressor that contributes to p21-regulated growth suppression during fusion process
24842713 we narrowed the regulatory region located ~272 kb upstream to FOXF1 to ~60 kb and showed that its loss correlated with a decrease of FOXF1 expression in vivo.
24186199 FOXF1 and p53 form a portion of a regulatory transcriptional network that appears to have an important role in cancer cell invasion and migration.
More...

AA Sequence

MSSAPEKQQPPHGGGGGGGGGGGAAMDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLT      1 - 70
LSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRR     71 - 140
PRGFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPS    141 - 210
HSVPHLPSNGGHSYMGGCGGAAAGEYPHHDSSVPASPLLPTGAGGVMEPHAVYSGSAAAWPPSASAALNS    211 - 280
GASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNA    281 - 350
MASSSMHSAGGGSYYHQQVTYQDIKPCVM                                             351 - 379
//

Text Mined References (46)

PMID Year Title
27145217 2016 Variable phenotypic presentation of a novel FOXF1 missense mutation in a single family.
27071622 2016 Pathogenetics of alveolar capillary dysplasia with misalignment of pulmonary veins.
26908052 2016 Forkhead Box F1 promotes breast cancer cell migration by upregulating lysyl oxidase and suppressing Smad2/3 signaling.
26383589 2015 Supportive evidence for FOXP1, BARX1, and FOXF1 as genetic risk loci for the development of esophageal adenocarcinoma.
26294094 2015 Targeted Resequencing of 29 Candidate Genes and Mouse Expression Studies Implicate ZIC3 and FOXF1 in Human VATER/VACTERL Association.
26293303 2015 FOXF1 inhibits hematopoietic lineage commitment during early mesoderm specification.
25472632 2014 Molecular and clinical analyses of 16q24.1 duplications involving FOXF1 identify an evolutionarily unstable large minisatellite.
25260753 2014 Forkhead Box F1 represses cell growth and inhibits COL1 and ARPC2 expression in lung fibroblasts in vitro.
25237908 2014 FOXF1 mediates mesenchymal stem cell fusion-induced reprogramming of lung cancer cells.
24842713 2014 Two deletions overlapping a distant FOXF1 enhancer unravel the role of lncRNA LINC01081 in etiology of alveolar capillary dysplasia with misalignment of pulmonary veins.
More...