Property Summary

NCBI Gene PubMed Count 49
PubMed Score 100.25
PubTator Score 56.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Refractive error 50 0.0 1.4

Expression

  Differential Expression (13)

Disease log2 FC p
colon cancer -2.900 1.5e-02
cutaneous lupus erythematosus 2.200 5.8e-04
cystic fibrosis 3.169 4.1e-06
facioscapulohumeral dystrophy 1.700 1.7e-02
intraductal papillary-mucinous carcinoma... -1.300 3.5e-02
intraductal papillary-mucinous neoplasm ... -1.900 8.8e-03
lung adenocarcinoma -2.100 7.2e-19
lung cancer -3.400 1.6e-05
malignant mesothelioma -3.300 4.6e-08
non-small cell lung cancer -2.688 2.0e-28
pancreatic cancer 1.400 3.5e-03
primary pancreatic ductal adenocarcinoma 1.385 3.4e-03
ulcerative colitis 1.500 5.4e-05

Gene RIF (36)

AA Sequence

MSSAPEKQQPPHGGGGGGGGGGGAAMDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLT      1 - 70
LSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRR     71 - 140
PRGFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPS    141 - 210
HSVPHLPSNGGHSYMGGCGGAAAGEYPHHDSSVPASPLLPTGAGGVMEPHAVYSGSAAAWPPSASAALNS    211 - 280
GASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNA    281 - 350
MASSSMHSAGGGSYYHQQVTYQDIKPCVM                                             351 - 379
//

Text Mined References (51)

PMID Year Title