Property Summary

NCBI Gene PubMed Count 257
Grant Count 214
R01 Count 162
Funding $11,615,262.26
PubMed Score 68.86
PubTator Score 238.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
malignant mesothelioma 3,162
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis 1.400 0.001

Synonym

Accession Q12933 A8K107 B4DPJ7 Q7Z337 Q96NT2
Symbols TRAP
TRAP3
MGC:45012

Gene

PANTHER Protein Class (1)

PDB

3M0A   3M0D   1D01   1CA4   1CA9   1CZY   1CZZ   1D00   1D0A   1D0J   1F3V   1QSC   3KNV   3M06  

Gene RIF (124)

PMID Text
26823737 TRAF2 expression was increased in gastric cancer patients as a result of DNA hypomethylation.
26521044 these findings reveal a novel mechanism by which TRAF2 mediates Lys63-linked ubiquitination of DUSP14, leading to DUSP14 activation in T cells
26510914 Data show that when death receptor 5 (DR5) is suppressed, caspase-8 may recruit and stabilize TNF receptor-associated factor 2 (TRAF2) to form a metastasis and invasion signaling complex, resulting in activation of ERK signaling.
26390021 Presented is the trimer-to-monomer equilibrium transition of the TRAF2 C-terminal domain using both chemical (dilution/guanidinium hydrochloride) and mechanical stress (high pressure) to induce the dissociation of the native protein into subunits.
26331901 There was a significant positive correlation between TRAF2 and TRAF4 expression levels in malignant pleural effusion cells
26221961 MAVS50, exposing a degenerate TRAF-binding motif within its N-terminus, effectively competed with full-length MAVS for recruiting TRAF2 and TRAF6
26011589 Data show that ectopic expression of interferon regulatory factor 1 (IRF-1) reduces NF-kappa B activity and suppresses TNF receptor-associated factor 2 (TRAF2) and inhibitor of apoptosis 1 protein (cIAP1) expression in breast cancer cells.
25882049 The results identify TRAF2 as an important biological suppressor of necroptosis in vitro and in vivo.
25797626 Knockdown of IRE1alpha by siRNA dramatically abrogated CXC195-induced activation of TRAF2, ASK and JNK, formation of an IRE1alpha-TRAF2-ASK1 complex and caspase- and mitochondrial-dependent apoptosis in T24 cells
25716317 Data indicate that TRAF interacting protein TRIP negatively regulates the TNFR-associated factor 2 (TRAF2) ubiquitin-dependent pathway by modulating the TRAF2-sphingosine 1-phosphate (S1P) interaction.
More...

AA Sequence

MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCA      1 - 70
ACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACK     71 - 140
GLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCG    141 - 210
KCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTA    211 - 280
TFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTY    281 - 350
DGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA    351 - 420
LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAI    421 - 490
FIKAIVDLTGL                                                               491 - 501
//

Text Mined References (273)

PMID Year Title
26823737 2015 Methylation status of TRAF2 is associated with the diagnosis and prognosis of gastric cancer.
26521044 2016 TRAF2-mediated Lys63-linked ubiquitination of DUSP14/MKP6 is essential for its phosphatase activity.
26510914 2015 Suppression of death receptor 5 enhances cancer cell invasion and metastasis through activation of caspase-8/TRAF2-mediated signaling.
26390021 2015 TNFR-Associated Factor-2 (TRAF2): Not Only a Trimer.
26331901 2015 Expression, correlation, and prognostic value of TRAF2 and TRAF4 expression in malignant plural effusion cells in human breast cancer.
26221961 2015 An Internally Translated MAVS Variant Exposes Its Amino-terminal TRAF-Binding Motifs to Deregulate Interferon Induction.
26011589 2015 IRF-1 inhibits NF-?B activity, suppresses TRAF2 and cIAP1 and induces breast cancer cell specific growth inhibition.
25882049 2015 TRAF2 is a biologically important necroptosis suppressor.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25797626 2015 IRE1?-TRAF2-ASK1 complex-mediated endoplasmic reticulum stress and mitochondrial dysfunction contribute to CXC195-induced apoptosis in human bladder carcinoma T24 cells.
More...