Property Summary

NCBI Gene PubMed Count 69
Grant Count 23
R01 Count 15
Funding $1,789,456.62
PubMed Score 14.88
PubTator Score 84.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.006
non-small cell lung cancer 1.138 0.000
lung cancer 1.700 0.000
ovarian cancer 1.100 0.000

Gene RIF (50)

PMID Text
26929380 A previously unobserved coiled-coil dimer conformation may precede dimer closure. TRAP1 exists in an autoinhibited state with the ATP lid bound to the ATP-binding pocket. ATP displaces this and signals the cis-bound ATP status to the next subunit.
26722505 TRAP1 is highly expressed in kidney cancer and correlates with patients prognosis
26517089 Overexpression of TRAP1 in breast cancer cells causes mitochondrial fusion, triggers mitochondria to form tubular networks, and suppresses cell migration and invasion in vitro and in vivo. These data link TRAP1-regulated mitochondrial dynamics and function with tumorigenesis in breast cancer.
26464709 Our results indicate that GRP94 and TRAP1 might contribute more to the carcinogenesis or biology of SCLC than HSP90alpha and HSP90beta
26202366 results of the present study show that TRAP1 provides cardioprotection against myocardial I/R by ameliorating mitochondrial dysfunction
26084290 TRAP1 is a downstream effector of BRAF cytoprotective pathway in mitochondria and TRAP1 targeting may represent a novel strategy to improve the activity of proapoptotic agents in BRAF-driven CRC cells.
26071104 a correlation between TRAP1 and AKT expression is found in vivo in human colorectal tumours. These results provide new insights into TRAP1 role in the regulation of cell migration in cancer cells, tumour progression and metastatic mechanisms.
26022780 The combined presence of pain, fatigue and nausea is strongly associated with p.Ile253Val (OR 7.5, P = 0.0001) and with two other interacting variants (OR 18, P = 0.0005).
25564869 Our findings demonstrate that SDH inhibition by TRAP1 is oncogenic not only by inducing pseudohypoxia, but also by protecting tumor cells from oxidative stress
25531069 crystal structure of the mitochondrial Hsp90, TRAP1, revealed an extension of the N-terminal beta-strand previously shown to cross between protomers in the closed state
More...

AA Sequence

MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFSTQTAEDKEEP      1 - 70
LHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPE     71 - 140
MEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFM    141 - 210
VADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNF    211 - 280
VSFPLYLNGRRMNTLQAIWMMDPKDVREWQHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKP    281 - 350
SMFDVSRELGSSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQ    351 - 420
RLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRM    421 - 490
RAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYK    491 - 560
EEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKT    561 - 630
QEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKA    631 - 700
LERH                                                                      701 - 704
//

Text Mined References (76)

PMID Year Title
26929380 2016 Mitochondrial Hsp90 is a ligand-activated molecular chaperone coupling ATP binding to dimer closure through a coiled-coil intermediate.
26722505 2015 Expression of tumor necrosis factor receptor-associated protein 1 and its clinical significance in kidney cancer.
26517089 2015 Aberrantly upregulated TRAP1 is required for tumorigenesis of breast cancer.
26464709 2015 Differential expression of heat shock protein 90 isoforms in small cell lung cancer.
26202366 2015 TRAP1 Provides Protection Against Myocardial Ischemia-Reperfusion Injury by Ameliorating Mitochondrial Dysfunction.
26084290 2015 Targeting TRAP1 as a downstream effector of BRAF cytoprotective pathway: a novel strategy for human BRAF-driven colorectal carcinoma.
26071104 2015 TRAP1 controls cell migration of cancer cells in metabolic stress conditions: Correlations with AKT/p70S6K pathways.
26022780 2015 Hurt, tired and queasy: Specific variants in the ATPase domain of the TRAP1 mitochondrial chaperone are associated with common, chronic "functional" symptomatology including pain, fatigue and gastrointestinal dysmotility.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25564869 2014 Inhibition of succinate dehydrogenase by the mitochondrial chaperone TRAP1 has anti-oxidant and anti-apoptotic effects on tumor cells.
More...