Property Summary

NCBI Gene PubMed Count 75
PubMed Score 81.67
PubTator Score 66.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy 1.702 6.1e-06
aldosterone-producing adenoma -1.002 1.8e-02
Astrocytoma, Pilocytic 1.100 3.3e-05
autosomal dominant Emery-Dreifuss muscul... 1.308 6.1e-03
Breast cancer -1.100 7.0e-05
cystic fibrosis -1.812 8.6e-07
dermatomyositis 1.400 2.9e-03
Down syndrome 1.100 2.9e-03
Duchenne muscular dystrophy 1.228 1.1e-05
esophageal adenocarcinoma 2.000 2.2e-02
glioblastoma 1.200 2.6e-03
group 3 medulloblastoma 1.600 2.4e-03
intraductal papillary-mucinous adenoma (... 1.300 4.7e-02
juvenile dermatomyositis 1.295 7.6e-10
malignant mesothelioma -2.800 6.5e-09
medulloblastoma, large-cell -1.200 8.3e-03
mucosa-associated lymphoid tissue lympho... 2.139 3.4e-02
ovarian cancer -3.500 1.5e-07
pancreatic cancer 1.100 5.6e-05
pituitary cancer 2.700 1.0e-08
primary pancreatic ductal adenocarcinoma 1.804 1.4e-03
psoriasis -1.100 2.5e-03

Protein-protein Interaction (2)

Gene RIF (37)

AA Sequence

MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHL      1 - 70
TTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVM     71 - 140
HSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIP    141 - 210
PPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDI    211 - 280
EFFITKLQKAAEAFSELSKRKKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQ    281 - 350
NPSAADLVHFLFTPLNMVVQATGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWMKARAEW    351 - 420
PKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADG    421 - 490
YAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEI    491 - 560
LDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADPPYTHTIQKQRMEYGPRPADTPPAPSPPPTP    561 - 630
APVPVPLPPSTPAPVPVSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTI    631 - 700
GRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEG    701 - 770
ARVYSQITVQKAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH                      771 - 822
//

Text Mined References (82)

PMID Year Title