Property Summary

NCBI Gene PubMed Count 67
Grant Count 34
R01 Count 19
Funding $3,761,754.45
PubMed Score 77.15
PubTator Score 66.16

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

PMID Text
26976596 Eps8 is required for continuous membrane blebbing.
26163656 Erk activity promotes actin bundling by Eps8 to enhance cortex tension and drive the bleb-based migration of cancer cells under non-adhesive confinement.
25843487 EPS8, as MDR1 and WT1, may be a clinically valuable biomarker for assessing the outcome of ALL patients.
25376540 These results indicate that employing the native and modified epitopes identified here in Eps8-based immunotherapy for HLA-A2.1 positive cancer patients may result in efficient anticancer immune responses for diverse tumor types.
25359883 Eps8 is a crucial mediator of Src- and FAK-regulated processes.
25333707 Eps8 is overexpressed in human breast cancers, possibly by regulating ERK signaling, MMP9, p53 and EMT-like transition to affect breast cancer cell growth, migration and invasion.
25031323 determined the alpha-synuclein-binding domain of beta-III tubulin and demonstrated that a short fragment containing this domain can suppress alpha-synuclein accumulation in the primary cultured cells
24741995 EPS8 is an F-actin capping and bundling protein. Mutant mice lacking EPS8 (Eps8-/- mice), which is present in the hair bundle, the sensory antenna of the auditory sensory cells that operate the mechano-electrical transduction
24409660 results suggest that Eps8 may serve as a prognostic factor of responsiveness to chemotherapy in AML patients
23626693 Novel binding partners and differentially regulated phosphorylation sites clarify Eps8 as a multi-functional adaptor.
More...

AA Sequence

MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHL      1 - 70
TTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVM     71 - 140
HSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIP    141 - 210
PPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDI    211 - 280
EFFITKLQKAAEAFSELSKRKKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQ    281 - 350
NPSAADLVHFLFTPLNMVVQATGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWMKARAEW    351 - 420
PKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADG    421 - 490
YAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEI    491 - 560
LDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADPPYTHTIQKQRMEYGPRPADTPPAPSPPPTP    561 - 630
APVPVPLPPSTPAPVPVSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTI    631 - 700
GRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEG    701 - 770
ARVYSQITVQKAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH                      771 - 822
//

Text Mined References (73)

PMID Year Title
26976596 2016 A RhoA and Rnd3 cycle regulates actin reassembly during membrane blebbing.
26163656 2015 Erk regulation of actin capping and bundling by Eps8 promotes cortex tension and leader bleb-based migration.
25843487 2015 Overexpression of EPS8 is associated with poor prognosis in patients with acute lymphoblastic leukemia.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
25376540 2015 Generation of cytotoxic T lymphocytes specific for native or modified peptides derived from the epidermal growth factor receptor pathway substrate 8 antigen.
25359883 2014 Eps8 controls Src- and FAK-dependent phenotypes in squamous carcinoma cells.
25333707 2015 Eps8 regulates cellular proliferation and migration of breast cancer.
25031323 2014 Dynamin1 is a novel target for IRSp53 protein and works with mammalian enabled (Mena) protein and Eps8 to regulate filopodial dynamics.
24741995 2014 EPS8, encoding an actin-binding protein of cochlear hair cell stereocilia, is a new causal gene for autosomal recessive profound deafness.
More...