Property Summary

NCBI Gene PubMed Count 18
Grant Count 132
R01 Count 42
Funding $55,473,597.11
PubMed Score 122.73
PubTator Score 78.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 4.300 0.000
astrocytic glioma -3.100 0.001
posterior fossa group A ependymoma -4.100 0.000
oligodendroglioma -2.400 0.008
glioblastoma -3.300 0.002
group 4 medulloblastoma 2.100 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell 1.600 0.007
adrenocortical carcinoma 1.318 0.018
active Crohn's disease -1.824 0.002
active ulcerative colitis -2.580 0.000
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -4.900 0.000
Breast cancer 1.400 0.004
ovarian cancer -2.000 0.000

Synonym

Accession Q12926 D3DRK3 Q13235 Q59G15 Q8NEM4 Q9H1Q8
Symbols HUB
HELN1
HEL-N1

Gene

Gene RIF (5)

PMID Text
26366417 The 17 proteins that interact with 10 or more other proteins (P < 0.05, FDR < 0.05) were identified as the hub proteins.
23512105 Tests for gene-environment interaction between these 33 genes and maternal smoking found evidence for interaction with two additional genes: GRID2 and ELAVL2 among European mothers
20818722 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18607064 increased level of mRNA transcripts detected in Small Cell Lung Cancer patients
15671036 the mutually antagonistic action of two RNA-binding proteins, Hu and hnRNP K, control the timing of the switch from proliferation to neuronal differentiation through the post-transcriptional regulation of p21 mRNA

AA Sequence

METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKL      1 - 70
VRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKE     71 - 140
LEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKT    141 - 210
NQAILSQLYQSPNRRYPGPLAQQAQRFRLDNLLNMAYGVKRFSPMTIDGMTSLAGINIPGHPGTGWCIFV    211 - 280
YNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVS    281 - 350
FKTNKTHKA                                                                 351 - 359
//

Text Mined References (21)

PMID Year Title
26366417 2015 Systematic Analysis of Endometrial Cancer-Associated Hub Proteins Based on Text Mining.
23512105 2013 Confirming genes influencing risk to cleft lip with/without cleft palate in a case-parent trio study.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20818722 2010 A Bayesian approach to genetic association studies with family-based designs.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18607064 2008 Molecular detection of neuron-specific ELAV-like-positive cells in the peripheral blood of patients with small-cell lung cancer.
More...