Property Summary

NCBI Gene PubMed Count 18
PubMed Score 122.73
PubTator Score 78.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Small cell carcinoma of lung 45
Disease Target Count P-value
ovarian cancer 8492 7.55161944021853E-19
posterior fossa group A ependymoma 1511 3.72593350525182E-16
pilocytic astrocytoma 3086 5.42737308038091E-16
malignant mesothelioma 3163 1.44775359787667E-9
atypical teratoid / rhabdoid tumor 4369 5.4294952387342E-5
pediatric high grade glioma 2712 1.16397206025551E-4
group 4 medulloblastoma 1875 1.96442362125291E-4
active ulcerative colitis 477 3.66609471353418E-4
astrocytic glioma 2241 0.0014416809655487
active Crohn's disease 918 0.00192696342547834
glioblastoma 5572 0.00219813802981082
Breast cancer 3099 0.00390289432114354
medulloblastoma, large-cell 6234 0.0072263878901246
oligodendroglioma 2849 0.00809426992865605
adrenocortical carcinoma 1427 0.0182532005405312

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 4.300 0.000
astrocytic glioma -3.100 0.001
posterior fossa group A ependymoma -4.100 0.000
oligodendroglioma -2.400 0.008
glioblastoma -3.300 0.002
group 4 medulloblastoma 2.100 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell 1.600 0.007
adrenocortical carcinoma 1.318 0.018
active Crohn's disease -1.824 0.002
active ulcerative colitis -2.580 0.000
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -4.900 0.000
Breast cancer 1.400 0.004
ovarian cancer -2.000 0.000

Synonym

Accession Q12926 D3DRK3 Q13235 Q59G15 Q8NEM4 Q9H1Q8
Symbols HUB
HELN1
HEL-N1

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (5)

PMID Text
26366417 The 17 proteins that interact with 10 or more other proteins (P < 0.05, FDR < 0.05) were identified as the hub proteins.
23512105 Tests for gene-environment interaction between these 33 genes and maternal smoking found evidence for interaction with two additional genes: GRID2 and ELAVL2 among European mothers
20818722 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18607064 increased level of mRNA transcripts detected in Small Cell Lung Cancer patients
15671036 the mutually antagonistic action of two RNA-binding proteins, Hu and hnRNP K, control the timing of the switch from proliferation to neuronal differentiation through the post-transcriptional regulation of p21 mRNA

AA Sequence

METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKL      1 - 70
VRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKE     71 - 140
LEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKT    141 - 210
NQAILSQLYQSPNRRYPGPLAQQAQRFRLDNLLNMAYGVKRFSPMTIDGMTSLAGINIPGHPGTGWCIFV    211 - 280
YNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVS    281 - 350
FKTNKTHKA                                                                 351 - 359
//

Text Mined References (21)

PMID Year Title
26366417 2015 Systematic Analysis of Endometrial Cancer-Associated Hub Proteins Based on Text Mining.
23512105 2013 Confirming genes influencing risk to cleft lip with/without cleft palate in a case-parent trio study.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20818722 2010 A Bayesian approach to genetic association studies with family-based designs.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18607064 2008 Molecular detection of neuron-specific ELAV-like-positive cells in the peripheral blood of patients with small-cell lung cancer.
More...