Property Summary

NCBI Gene PubMed Count 89
PubMed Score 177.87
PubTator Score 162.58

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
lung carcinoma 2844 1.07591495625375E-35
glioblastoma multiforme 347 3.62536883722491E-18
lung adenocarcinoma 2714 9.48397661326336E-8
malignant mesothelioma 3163 4.2187818372937E-7
ovarian cancer 8492 1.22143599006328E-6
lung cancer 4473 2.7603223302379E-6
interstitial cystitis 2299 6.51097894611761E-5
cystic fibrosis 1670 3.22017631954064E-4
group 4 medulloblastoma 1875 6.32978369017335E-4
active Crohn's disease 918 0.00335735790357191
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00367440024382512
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00442070653555291
active ulcerative colitis 477 0.0223406941623211
spina bifida 1064 0.0382878998403195
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.615 1.8
Polyneuropathy 30 3.192 1.6


  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
glioblastoma multiforme 1.200 0.000
cystic fibrosis 2.052 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.004
intraductal papillary-mucinous carcinoma... -1.400 0.004
lung cancer -2.400 0.000
active Crohn's disease 1.662 0.003
active ulcerative colitis 1.231 0.022
interstitial cystitis -1.700 0.000
lung adenocarcinoma -1.200 0.000
group 4 medulloblastoma -2.100 0.001
lung carcinoma -3.400 0.000
spina bifida -2.061 0.038
ovarian cancer -2.900 0.000


Accession Q12923 B2RTR0 Q15159 Q15263 Q15264 Q15265 Q15674 Q16826 Q8IWH7 Q9NYN9 Q9UDA8
Symbols PNP1



1D5G   1Q7X   1WCH   2M0Z   2M10   3LNX   3LNY   3PDZ  

  Ortholog (12)

Gene RIF (55)

25933631 This work studied heat diffusion in the well-known PDZ-2 protein, and confirmed that this protein has two cognate allosteric pathways and that heat flows preferentially through these.
25893857 Necl-4 serves as a novel regulator for contact inhibition of cell movement and proliferation cooperatively with the VEGF receptor and PTPN13
25494785 The effect of the viscogens sucrose, and glycerol on the kinetic response of a photoperturbed PTPN13 is investigated.
25448478 A PDZ-mediated interaction of PTPN13 and PTEN is described with possible relevance for tumor suppression.
25365469 A comprehensive molecular dynamics simulation study of the PDZ2 domain of human tyrosine phosphatase 1E in the ligand-bound and -free state, as well as the photoswitchable protein in the cis and trans states of the photoswitch
24338422 Association of rs7014346 in POU5F1P1, rs989902 in PTPN13, and rs7003146 in TCF7L2 with variations in the risk of breast cancer in a Chinese Han population.
24316673 selective autophagic degradation of the phosphatase Fap-1 promotes Fas apoptosis.
24191246 Thus, our results suggest a previously unknown Stat3-PTPN13 molecular network controlling squamous cell lung carcinoma development
23950995 HCV induced increased expression of miR200c can down modulate the expression of FAP1, a critical regulator of Src and MAP kinase pathway that play an important role in the production of fibrogenic growth factors and development of fibrosis.
23906871 Low PTPN13 expression is associated with invasion and metastasis of lung squamous cell carcinoma.

AA Sequence

VQTEDQYIFCYQVILYVLTRLQAEEEQKQQPQLLK                                      2451 - 2485

Text Mined References (94)

PMID Year Title
25933631 2015 Allosteric communication pathways and thermal rectification in PDZ-2 protein: a computational study.
25893857 2015 The Cell Adhesion Molecule Necl-4/CADM4 Serves as a Novel Regulator for Contact Inhibition of Cell Movement and Proliferation.
25494785 2014 Effect of viscogens on the kinetic response of a photoperturbed allosteric protein.
25448478 2015 PTEN-PDZ domain interactions: binding of PTEN to PDZ domains of PTPN13.
25365469 2014 Long-range conformational transition of a photoswitchable allosteric protein: molecular dynamics simulation study.
24338422 2013 Colorectal cancer susceptibility variants alter risk of breast cancer in a Chinese Han population.
24316673 2014 Autophagy variation within a cell population determines cell fate through selective degradation of Fap-1.
24191246 2013 Stat3 inhibits PTPN13 expression in squamous cell lung carcinoma through recruitment of HDAC5.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23950995 2013 Hepatitis C virus induced miR200c down modulates FAP-1, a negative regulator of Src signaling and promotes hepatic fibrosis.