Property Summary

NCBI Gene PubMed Count 80
Grant Count 82
R01 Count 65
Funding $10,492,529.34
PubMed Score 110.63
PubTator Score 151.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q12913 Q15255 Q6P4H4 Q8NHM2 Q9UDA9 Protein-tyrosine phosphatase eta
Symbols DEP1
SCC1
CD148
HPTPeta
R-PTP-ETA

Gene

PDB

2CFV   2DLE   2NZ6  

Gene RIF (56)

PMID Text
26063811 These results demonstrated Ptprj as a physiological enzyme that attenuates insulin signalling in vivo, and indicate that an inhibitor of Ptprj may be an insulin-sensitizing agent.
25791119 the combination of CD200 and CD148 may have a potential differential diagnostic value in leukemic B-CLPDs, especially between CLL and MCL.
25772245 Moderate expression of DEP-1 was associated with the increased relapse.
25672645 The studies suggest induction of MMP-9 expression promoted by DEP-1 deficiency.
25634668 C33A cells lacking PTPRJ had increased cell viability, growth, migration, G1-S transition, and 5-FU resistance. PTPRJ negatively regulated the JAK1/STAT3 pathway by decreasing phosphorylation levels of JAK1 and STAT3 and expression of downstream factors.
25412306 The expression profiles of DEP1 and B2MG correlate with increased cell senescence and survival in breast cancer.
25386896 CD148 tyrosine phosphatase promotes e-cadherin cell adhesion.
24583284 Phosphorylation of T1318 is part of a regulatory mechanism that channels the activity of DEP-1 towards Src to allow its optimal activation and the promotion of endothelial cell permeability.
24027763 our data support the notion of DEP-1 as positive functional regulator in vascular cerebral arteriogenesis, involving differential PDGF-B gene expression.
24016860 Data indicate that CD148 is upregulated in macrophages and T cells in rheumatoid arthritis (RA) samples, and its activity is enhanced by treatment with tumour necrosis factor alpha (TNFalpha), and reduced by synovial fluid or oxidising conditions.
More...

AA Sequence

MKPAAREARLPPRSPGLRWALPLLLLLLRLGQILCAGGTPSPIPDPSVATVATGENGITQISSTAESFHK      1 - 70
QNGTGTPQVETNTSEDGESSGANDSLRTPEQGSNGTDGASQKTPSSTGPSPVFDIKAVSISPTNVILTWK     71 - 140
SNDTAASEYKYVVKHKMENEKTITVVHQPWCNITGLRPATSYVFSITPGIGNETWGDPRVIKVITEPIPV    141 - 210
SDLRVALTGVRKAALSWSNGNGTASCRVLLESIGSHEELTQDSRLQVNISGLKPGVQYNINPYLLQSNKT    211 - 280
KGDPLGTEGGLDASNTERSRAGSPTAPVHDESLVGPVDPSSGQQSRDTEVLLVGLEPGTRYNATVYSQAA    281 - 350
NGTEGQPQAIEFRTNAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAV    351 - 420
IPGLRSSTFYNITVCPVLGDIEGTPGFLQVHTPPVPVSDFRVTVVSTTEIGLAWSSHDAESFQMHITQEG    421 - 490
AGNSRVEITTNQSIIIGGLFPGTKYCFEIVPKGPNGTEGASRTVCNRTVPSAVFDIHVVYVTTTEMWLDW    491 - 560
KSPDGASEYVYHLVIESKHGSNHTSTYDKAITLQGLIPGTLYNITISPEVDHVWGDPNSTAQYTRPSNVS    561 - 630
NIDVSTNTTAATLSWQNFDDASPTYSYCLLIEKAGNSSNATQVVTDIGITDATVTELIPGSSYTVEIFAQ    631 - 700
VGDGIKSLEPGRKSFCTDPASMASFDCEVVPKEPALVLKWTCPPGANAGFELEVSSGAWNNATHLESCSS    701 - 770
ENGTEYRTEVTYLNFSTSYNISITTVSCGKMAAPTRNTCTTGITDPPPPDGSPNITSVSHNSVKVKFSGF    771 - 840
EASHGPIKAYAVILTTGEAGHPSADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSQSLSEVLKYEIDVGN    841 - 910
ESTTLGYYNGKLEPLGSYRACVAGFTNITFHPQNKGLIDGAESYVSFSRYSDAVSLPQDPGVICGAVFGC    911 - 980
IFGALVIVTVGGFIFWRKKRKDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKL    981 - 1050
VGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTL   1051 - 1120
KDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTS   1121 - 1190
ESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIE   1191 - 1260
NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFG   1261 - 1330
KTNGYIA                                                                  1331 - 1337
//

Text Mined References (86)

PMID Year Title
26063811 2015 The R3 receptor-like protein tyrosine phosphatase subfamily inhibits insulin signalling by dephosphorylating the insulin receptor at specific sites.
25791119 2015 Expression patterns of CD200 and CD148 in leukemic B-cell chronic lymphoproliferative disorders and their potential value in differential diagnosis.
25772245 2015 The protein tyrosine phosphatase DEP-1/PTPRJ promotes breast cancer cell invasion and metastasis.
25672645 2015 Deficiency of the protein-tyrosine phosphatase DEP-1/PTPRJ promotes matrix metalloproteinase-9 expression in meningioma cells.
25634668 2015 Blockage of PTPRJ promotes cell growth and resistance to 5-FU through activation of JAK1/STAT3 in the cervical carcinoma cell line C33A.
25412306 2014 Characterization of novel markers of senescence and their prognostic potential in cancer.
25386896 2014 CD148 tyrosine phosphatase promotes cadherin cell adhesion.
25173106 2014 Genome-wide analysis of multi-ancestry cohorts identifies new loci influencing intraocular pressure and susceptibility to glaucoma.
24583284 2014 Phosphorylation of DEP-1/PTPRJ on threonine 1318 regulates Src activation and endothelial cell permeability induced by vascular endothelial growth factor.
24357727 2014 A meta-analysis of genome-wide association studies identifies ORM1 as a novel gene controlling thrombin generation potential.
More...