Property Summary

NCBI Gene PubMed Count 16
PubMed Score 16.83
PubTator Score 13.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease -1.246 1.5e-02
Chronic Lymphocytic Leukemia 1.215 2.0e-03
colon cancer -1.100 1.0e-02
group 3 medulloblastoma -1.100 1.4e-02
intraductal papillary-mucinous adenoma (... -1.500 4.6e-03
intraductal papillary-mucinous carcinoma... -2.200 1.3e-02
intraductal papillary-mucinous neoplasm ... -2.300 2.1e-03
lung cancer -1.600 2.0e-03
lung carcinoma -1.500 1.2e-16
medulloblastoma, large-cell -1.300 3.2e-03
nasopharyngeal carcinoma -1.400 4.4e-02
osteosarcoma -1.929 1.9e-03
pancreatic cancer -1.200 3.7e-02
periodontitis 1.100 3.6e-20
primary pancreatic ductal adenocarcinoma -1.210 2.9e-02
primary Sjogren syndrome 1.900 2.0e-04

Gene RIF (7)

AA Sequence

MESTPFSGVANQIHTLCERPTYGEVKDGALDVKRQHKCPGPTSGPSPGTNLSGCIRMNDDPSMEENGVER      1 - 70
VCPESLLQSREYSSLPLPRHTSSTDGTITSSDPGLEILNMASCDLDRNSLCKKEEDTRSASPTIEAQGTS     71 - 140
PAHDNIAFQDSTSKDKTILNLEAKEEPETIEEHKKEHASGDSVVSPLPVTTVKSVNLRQSENTSANEKEV    141 - 210
EAEFLRLSLGFKCDWFTLEKRVKLEERSRDLAEENLKKEITNCLKLLESLTPLCEDDNQAQEIIKKLEKS    211 - 280
IKFLSQCAARVASRAEMLGAINQESRVSKAVEVMIQHVENLKRMYAKEHAELEELKQVLLQNERSFNPLE    281 - 350
DDDDCQIKKRSASLNSKPSSLRRVTIASLPRNIGNAGMVAGMENNDRFSRRSSSWRILGSKQSEHRPSLP    351 - 420
RFISTYSWADAEEEKCELKTKDDSEPSGEETVERTRKPSLSEKKNNPSKWDVSSVYDTIASWATNLKSSI    421 - 490
RKANKALWLSIAFIVLFAALMSFLTGQLFQKSVDAAPTQQEDSWTSLEHILWPFTRLRHNGPPPV         491 - 555
//

Text Mined References (22)

PMID Year Title