Property Summary

Ligand Count 195
NCBI Gene PubMed Count 58
PubMed Score 471.50
PubTator Score 271.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
nephrosclerosis -1.117 9.0e-03

Gene RIF (49)

AA Sequence

MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLGHIKRPWGICV      1 - 70
GFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVDGDMDLSVSMTTCSTLLALGM     71 - 140
MPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGMFVNHKWPQKAKIILKIGSIAGAILIVLIAV    141 - 210
VGGILYQSAWIIAPKLWIIGTIFPVAGYSLGFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTP    211 - 280
EELNVVFTFPLIYSIFQLAFAAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK      281 - 348
//

Text Mined References (60)

PMID Year Title