Property Summary

NCBI Gene PubMed Count 57
Grant Count 76
R01 Count 49
Funding $11,628,397.63
PubMed Score 417.47
PubTator Score 271.02

Knowledge Summary

Patent

No data available

Synonym

Accession Q12908 A1L4F4 Q13839
Symbols ASBT
IBAT
ISBT
PBAM
NTCP2

Gene

PANTHER Protein Class (2)

Gene RIF (48)

PMID Text
25902143 Data (including data from studies in knockout/transgenic mice) suggest that SLC10A2 is a functional receptor for hepatitis D virus in hepatocytes.
25855079 Results unravel novel roles for N-glycosylation of ASBT and suggest that high levels of glucose alter the composition of the glycan and may contribute to the increase in ASBT function in diabetes mellitus.
25418280 The p.Ser267Phe NTCP variant is significantly associated with resistance to chronic hepatitis B and a lower incidence of acute-on-chronic liver failure. Our results support that NTCP is a cellular receptor for HBV in human infection
25239307 Data indicate that the lipid flippase (ATP8B1)-transmembrane protein 30A (CDC50A) heterodimer is essential for the apical localization of sodium-dependent bile acid transporter (SLC10A2/ASBT) in Caco-2 cells.
24498857 It was conclude that regulation of ASBT expression by resveratrol (RSV) may have clinical relevance with regard to the observed cholesterol-lowering effects of RSV.
24045943 Transmembrane domain II of the human bile acid transporter SLC10A2 coordinates sodium translocation.
22669917 ASBT evolved from the earliest vertebrates by gaining affinity for modern bile salts while retaining affinity for older bile salts
22403793 This study provided novel evidence for the alterations in the activity of ASBT by enteropathogenic Escherichia coli infection.
22093174 There was no significant association of rs9514089 with gallstone risk, serum lipid parameters and BMI in the Sorbs and in the meta-analysis of all three cohorts. [meta-analysis]
22016432 The human ASBT promoter was activated transcriptionally by CDX1 and CDX2.
More...

AA Sequence

MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLGHIKRPWGICV      1 - 70
GFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVDGDMDLSVSMTTCSTLLALGM     71 - 140
MPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGMFVNHKWPQKAKIILKIGSIAGAILIVLIAV    141 - 210
VGGILYQSAWIIAPKLWIIGTIFPVAGYSLGFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTP    211 - 280
EELNVVFTFPLIYSIFQLAFAAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK      281 - 348
//

Text Mined References (59)

PMID Year Title
25902143 2015 Hepatitis D Virus Infection of Mice Expressing Human Sodium Taurocholate Co-transporting Polypeptide.
25855079 2015 N-glycosylation is essential for ileal ASBT function and protection against proteases.
25418280 2015 The p.Ser267Phe variant in SLC10A1 is associated with resistance to chronic hepatitis B.
25239307 2014 The lipid flippase heterodimer ATP8B1-CDC50A is essential for surface expression of the apical sodium-dependent bile acid transporter (SLC10A2/ASBT) in intestinal Caco-2 cells.
24498857 2014 Resveratrol promotes degradation of the human bile acid transporter ASBT (SLC10A2).
24045943 2013 Transmembrane domain II of the human bile acid transporter SLC10A2 coordinates sodium translocation.
22960999 2012 Genome-wide association analyses of esophageal squamous cell carcinoma in Chinese identify multiple susceptibility loci and gene-environment interactions.
22669917 2012 Evolution of substrate specificity for the bile salt transporter ASBT (SLC10A2).
22403793 2012 Enteropathogenic Escherichia coli inhibits ileal sodium-dependent bile acid transporter ASBT.
22093174 2011 Effects of SLC10A2 variant rs9514089 on gallstone risk and serum cholesterol levels- meta-analysis of three independent cohorts.
More...