Property Summary

NCBI Gene PubMed Count 23
PubMed Score 24.90
PubTator Score 23.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.032 0.006
osteosarcoma -1.361 0.001
pancreatic ductal adenocarcinoma liver m... -1.107 0.016
group 3 medulloblastoma 1.500 0.000
non primary Sjogren syndrome sicca 1.400 0.024
ovarian cancer 1.700 0.000

Synonym

Accession Q12907 Q53HH1
Symbols GP36B
VIP36
C5orf8

Gene

PANTHER Protein Class (1)

Gene RIF (8)

PMID Text
23269669 Interaction with VIP36 is dependent on glycosylation at the same sites that allow GC-C to fold and bind ligand.
22190034 HIV-1 gp41 is identified to have a physical interaction with lectin, mannose-binding 2 (LMAN2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 gp41 is identified to have a physical interaction with lectin, mannose-binding 2 (LMAN2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20477988 Results identify the glycoprotein alpha1-antitrypsin as a cargo of VIP36.
18854154 Knockdown of lectin, mannose-binding 2 (LMAN2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18025080 selective interaction of VIPL and VIP36 with the deglucosylated trimannose in the D1 branch of high-mannose-type oligosaccharides but with different pH dependence.
17586539 VIP36 interacts with molecular chaperone BiP and has a role in the quality control of secretory proteins
11359937 Live imaging of the canine homologous protein.

AA Sequence

MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSS      1 - 70
SMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRD     71 - 140
RLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRD    141 - 210
HDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEH    211 - 280
TPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIVVCAVVGAVVFQKRQE    281 - 350
RNKRFY                                                                    351 - 356
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23701871 2013 Parallel quantification of lectin-glycan interaction using ultrafiltration.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23269669 2013 Site-specific N-linked glycosylation of receptor guanylyl cyclase C regulates ligand binding, ligand-mediated activation and interaction with vesicular integral membrane protein 36, VIP36.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
22016386 2011 VIP36 protein is a target of ectodomain shedding and regulates phagocytosis in macrophage Raw 264.7 cells.
21269460 2011 Initial characterization of the human central proteome.
20477988 2010 Role of the lectin VIP36 in post-ER quality control of human alpha1-antitrypsin.
More...