Property Summary

NCBI Gene PubMed Count 24
PubMed Score 27.47
PubTator Score 23.86

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.500 3.1e-04
Multiple myeloma 1.032 6.5e-03
non primary Sjogren syndrome sicca 1.400 2.4e-02
osteosarcoma -1.361 1.2e-03
ovarian cancer 1.700 3.1e-06
pancreatic ductal adenocarcinoma liver m... -1.107 1.6e-02

Protein-protein Interaction (4)

Gene RIF (9)

AA Sequence

MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSS      1 - 70
SMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRD     71 - 140
RLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRD    141 - 210
HDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEH    211 - 280
TPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIVVCAVVGAVVFQKRQE    281 - 350
RNKRFY                                                                    351 - 356
//

Text Mined References (27)

PMID Year Title