Property Summary

NCBI Gene PubMed Count 91
Grant Count 65
R01 Count 56
Funding $4,612,642.81
PubMed Score 135.80
PubTator Score 125.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.007 0.014
Multiple myeloma 1.823 0.000
ependymoma 1.700 0.000
oligodendroglioma 1.600 0.023
psoriasis -1.800 0.000
astrocytoma 1.500 0.004
glioblastoma 1.700 0.000
osteosarcoma -1.154 0.000
sonic hedgehog group medulloblastoma 2.900 0.000
atypical teratoid/rhabdoid tumor 2.500 0.000
medulloblastoma, large-cell 2.900 0.000
primitive neuroectodermal tumor 2.100 0.000
adrenocortical carcinoma 1.029 0.000
lung cancer 2.100 0.000
colon cancer 1.300 0.000
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma -1.320 0.008
lung adenocarcinoma 1.451 0.000
gastric carcinoma 1.200 0.027
ovarian cancer 2.700 0.000
dermatomyositis 1.300 0.001

Synonym

Accession Q12906 A8K6F2 G5E9M5 O43409 Q6P1X1 Q86XY7 Q99544 Q99545 Q9BZH4 Q9BZH5 Q9NQ95 Q9NQ96 Q9NQ97 Q9NQ98 Q9NQ99 Q9NQA0 Q9NQA1 Q9NQA2 Q9NRN2 Q9NRN3 Q9NRN4 Q9UMZ9 Q9UN00 Q9UN84 Q9UNA2
Symbols CBTF
DRBF
MMP4
MPP4
NF90
NFAR
NF110
NF90a
NF90b
NFAR2
TCP80
DRBP76
NF110b
NFAR-1
TCP110
MPHOSPH4
NF-AT-90

Gene

PDB

2L33   3P1X  

Gene RIF (61)

PMID Text
26891316 Deletion of the RNA binding domains of NF45 and NF90 diminished the enhancement of HIV infection and gene expression.
26795062 The NF90 C-terminus is involved in conformational changes in the protein after RNA binding.
26712564 These data suggest that, like ADAR2, underlying sequences in dsRNA may influence how NF90 recognizes its target RNAs
26491010 data suggest that lncRNA SALNR modulates cellular senescence at least partly through changing NF90 activity
26381409 The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators.
26273641 Taken together, our discovery of the function of TCP80 and RHA in regulating p53 IRES and p53 induction following DNA damage provides a better understanding of the mechanisms that regulate IRES-mediated p53 translation in response to genotoxic stress.
26240280 NF45 and NF90 are novel higher-eukaryote-specific factors required for the maturation of 60S ribosomal subunits.
25544776 Data indicate the role of cyclin-dependent kinase inhibitor 1A (p21) and interleukin enhancer binding factor 3 (ILF3) pathway in mediating the anti-leukemic activity of sodium dichloroacetate (DCA) in oncoprotein p53null leukemic cells.
25447144 the role of the human NF90 protein isoforms in DNA and RNA virus replication
25399696 Suppression of NF90 caused a decrease in the half-life of cyclin E1 mRNA
25010285 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
24920670 These results suggest a novel molecular mechanism for the modulation of RNA granule assembly and disassembly by NFAR2, NF45, and phosphorylation at double-stranded RNA-activated kinase PKR sites.
24623135 NF90 exerts antiviral activity through regulation of PKR phosphorylation and stress granules in infected cells.
23965975 The function of NF90 in posttranscriptional gene regulation and microRNA biogenesis. [Review]
23874603 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23117626 contributes to maintaining low levels of senescence-associated secretory phenotype factors in non-senescent cells
22986534 Data indicate that knockdown of interleukin enhancer-binding factor 3 (ILF3) leads to the increased levels of mature urokinase-type plasminogen activator (uPA) mRNA-targeting miRNAs miR-193a, miR-193b and miR-181a.
22442257 The unique C-terminal region of ILF3/NF110 is important for promoting survivin expression and for high affinity binding to YM155.
22174317 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21987769 These data suggest that DRBP76, via its association with VP35, exerts an anti-Ebola virus function.
21971700 high expression of ERCC1, XPB and ILF3 was observed in human epithelial ovarian cancer
21969602 The NF90/NF45 complex participates in DNA break repair via nonhomologous end joining
21811582 The protein polymorphism of Ilf3/NF90 and the various subcellular localizations of their isoforms may partially explain the various functions previously reported for these proteins.
21468600 The relationship between rs6929846 of BTN2A1 or rs2569512 of ILF3 and myocardial infarction is influenced by the serum concentrations of high density lipoprotein cholesterol and low density lipoprotein cholesterol, respectively.
21386893 NF90 binds the dengue virus RNA 3' terminus and is a positive regulator of dengue virus.
21364984 Production of HIV particles is regulated by altering sub-cellular localization and dynamics of Rev induced by double-strand RNA binding protein.
21364984 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21364984 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21364984 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21364984 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21347509 associations of rs2569512 of ILF3 to myocardial infarction among individuals stratified by the absence or presence of hypertension, diabetes mellitus and chronic kidney disease
20668518 Data suggest that physiologic DRBP76 expression, isoform distribution and subcellular localization are profoundly altered upon malignant transformation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20051514 our results identify NF45 and NF90 as novel regulators of HS4-dependent human IL13 transcription in response to T cell activation
19913121 Observational study of gene-disease association. (HuGE Navigator)
19494010 NF90 inhibits influenza virus replication during the early phase of infection through direct interaction with viral NP.
19454010 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19398578 Results suggest that the association of the NF90-NF45 complex with pri-miRNAs impairs access of the Microprocessor complex to the pri-miRNAs, resulting in a reduction of mature miRNA production.
19116932 ILF-3, which has been known to regulate IL-2 expression in T cells, up-regulates synoviolin expression with GABPalpha in rheumatoid synovial cells
18490444 MKP-1 upregulation by oxidative stress is potently influenced by increased mRNA stability and translation, mediated at least in part by the RNA-binding proteins HuR and NF90.
18458058 Cell growth is retarded and giant multinucleated cells accumulate when the expression of NF45 or NF90, but not NF110, is reduced in HeLa cells.
18337511 NFARs exert influence on mRNA trafficking and the modulation of translation rates and may constitute an innate immune translational surveillance mechanism important in host defense countermeasures against virus infection
18097023 CD28 costimulation activates AKT to phosphorylate NF90 at Ser647 and phosphorylation triggers NF90 to relocate to the cytoplasm and stabilize IL-2 mRNA.
18039850 DRBP76/NF90 isoform facilitates VEGF expression by promoting VEGF mRNA loading onto polysomes
17565699 Our results show that perturbation Tat/TAR RNA interaction by the dsRNA binding nuclear factor 90 protein is sufficient to inhibit transcriptional activation of HIV-1.
17565699 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
17565699 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
17125513 The human Nuclear Factor 90 c-terminal variant protein encoded by ILF3 interacts with Rev to inhibit Rev-mediated RNA transport.
17125513 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
17125513 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 3 (ILF3, NF90), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
16055709 ADAR1 has the potential both to change information content through editing of mRNA and to regulate gene expression through interacting with NF90
15811368 NF90 and NF110 engage RNA differentially and translocate from the nucleus to the cytoplasm in mitosis
14654356 the multiple cellular functions, i.e., translation control, interleukin-2 enhancer binding, or cell division, of ILF3 are fulfilled by alternatively spliced isoforms.
14570900 nuclear export of ILF3 is mediated by exportin-5 and minihelix-containing RNA
12946349 Results describe the expression of four isoforms of nuclear factor 90, including NF110, by cDNA cloning and mass spectrometric analysis of proteins isolated from human cells
12504009 Nuclear export of this protein is required for interleukin-2 mRNA stabilization.
11958450 plays important role in protein priming of HBV polymerase

AA Sequence

MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPE      1 - 70
DDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAAVT     71 - 140
EDKYEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEMEKVLAGETLSVNDPPDVLDRQKCLAALASL    141 - 210
RHAKWFQARANGLKSCVIVIRVLRDLCTRVPTWGPLRGWPLELLCEKSIGTANRPMGAGEALRRVLECLA    211 - 280
SGIVMPDGSGIYDPCEKEATDAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPKNE    281 - 350
NPVDYTVQIPPSTTYAITPMKRPMEEDGEEKSPSKKKKKIQKKEEKAEPPQAMNALMRLNQLKPGLQYKL    351 - 420
VSQTGPVHAPIFTMSVEVDGNSFEASGPSKKTAKLHVAVKVLQDMGLPTGAEGRDSSKGEDSAEETEAKP    421 - 490
AVVAPAPVVEAVSTPSAAFPSDATAEQGPILTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVE    491 - 560
VDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANKKKRAPVPVRGGPKFAAKPHNPGFGMGGPMH    561 - 630
NEVPPPPNLRGRGRGGSIRGRGRGRGFGGANHGGYMNAGAGYGSYGYGGNSATAGYSQFYSNGGHSGNAS    631 - 700
GGGGGGGGGSSGYGSYYQGDNYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPP    701 - 770
QGKQKGYNHGQGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGS    771 - 840
GGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNYQYR                    841 - 894
//

Text Mined References (104)

PMID Year Title
26891316 2016 NF45 and NF90 Bind HIV-1 RNA and Modulate HIV Gene Expression.
26795062 2016 Coordinated Action of Two Double-Stranded RNA Binding Motifs and an RGG Motif Enables Nuclear Factor 90 To Flexibly Target Different RNA Substrates.
26712564 2016 Nuclear factor 90 uses an ADAR2-like binding mode to recognize specific bases in dsRNA.
26491010 2015 Senescence-associated Long Non-coding RNA (SALNR) Delays Oncogene-induced Senescence through NF90 Regulation.
26381409 2015 The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators.
26273641 2015 Translational Control Protein 80 Stimulates IRES-Mediated Translation of p53 mRNA in Response to DNA Damage.
26240280 2015 The NF45/NF90 Heterodimer Contributes to the Biogenesis of 60S Ribosomal Subunits and Influences Nucleolar Morphology.
25544776 2015 The anti-leukemic activity of sodium dichloroacetate in p53mutated/null cells is mediated by a p53-independent ILF3/p21 pathway.
25447144 2015 NF90 isoforms, a new family of cellular proteins involved in viral replication?
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25399696 2015 Regulation of cell cycle of hepatocellular carcinoma by NF90 through modulation of cyclin E1 mRNA stability.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24920670 2014 RNA granule assembly and disassembly modulated by nuclear factor associated with double-stranded RNA 2 and nuclear factor 45.
24623135 2014 NF90 exerts antiviral activity through regulation of PKR phosphorylation and stress granules in infected cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23965975 2013 NF90 in posttranscriptional gene regulation and microRNA biogenesis.
23853584 2013 The interactomes of influenza virus NS1 and NS2 proteins identify new host factors and provide insights for ADAR1 playing a supportive role in virus replication.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23117626 2012 NF90 coordinately represses the senescence-associated secretory phenotype.
22986534 2013 Interleukin enhancer-binding factor 3 promotes breast tumor progression by regulating sustained urokinase-type plasminogen activator expression.
22810585 2012 Viral immune modulators perturb the human molecular network by common and unique strategies.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22442257 2012 Interleukin enhancer-binding factor 3/NF110 is a target of YM155, a suppressant of survivin.
21987769 2011 DRBP76 associates with Ebola virus VP35 and suppresses viral polymerase function.
21971700 2012 Correlations among ERCC1, XPB, UBE2I, EGF, TAL2 and ILF3 revealed by gene signatures of histological subtypes of patients with epithelial ovarian cancer.
21969602 2011 The NF90/NF45 complex participates in DNA break repair via nonhomologous end joining.
21811582 2011 L-Ilf3 and L-NF90 traffic to the nucleolus granular component: alternatively-spliced exon 3 encodes a nucleolar localization motif.
21468600 Association of polymorphisms of BTN2A1 and ILF3 with myocardial infarction in Japanese individuals with different lipid profiles.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21386893 2011 NF90 binds the dengue virus RNA 3' terminus and is a positive regulator of dengue virus replication.
21364984 2011 Production of HIV particles is regulated by altering sub-cellular localization and dynamics of Rev induced by double-strand RNA binding protein.
21347509 2011 Association of polymorphisms of BTN2A1 and ILF3 with myocardial infarction in Japanese individuals with or without hypertension, diabetes mellitus or chronic kidney disease.
21269460 2011 Initial characterization of the human central proteome.
21123651 2010 Phosphorylation of the NFAR proteins by the dsRNA-dependent protein kinase PKR constitutes a novel mechanism of translational regulation and cellular defense.
20668518 2010 Tissue type-specific expression of the dsRNA-binding protein 76 and genome-wide elucidation of its target mRNAs.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20051514 2010 NF45 and NF90 regulate HS4-dependent interleukin-13 transcription in T cells.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19494010 2009 Nuclear factor 90 negatively regulates influenza virus replication by interacting with viral nucleoprotein.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19398578 2009 The NF90-NF45 complex functions as a negative regulator in the microRNA processing pathway.
19116932 2009 Activation of synoviolin promoter in rheumatoid synovial cells by a novel transcription complex of interleukin enhancer binding factor 3 and GA binding protein alpha.
19029303 2009 Control of c-myc mRNA stability by IGF2BP1-associated cytoplasmic RNPs.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18490444 2008 MKP-1 mRNA stabilization and translational control by RNA-binding proteins HuR and NF90.
18458058 2008 Nuclear factor 45 (NF45) is a regulatory subunit of complexes with NF90/110 involved in mitotic control.
18337511 2008 NFAR-1 and -2 modulate translation and are required for efficient host defense.
18097023 2008 Nuclear export of NF90 to stabilize IL-2 mRNA is mediated by AKT-dependent phosphorylation at Ser647 in response to CD28 costimulation.
18039850 2008 Double-stranded RNA-binding protein regulates vascular endothelial growth factor mRNA stability, translation, and breast cancer angiogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17890166 2007 The nuclear PP1 interacting protein ZAP3 (ZAP) is a putative nucleoside kinase that complexes with SAM68, CIA, NF110/45, and HNRNP-G.
17565699 2007 Nuclear Factor 90(NF90) targeted to TAR RNA inhibits transcriptional activation of HIV-1.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17125513 2006 Nuclear Factor 90, a cellular dsRNA binding protein inhibits the HIV Rev-export function.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
16055709 2005 ADAR1 interacts with NF90 through double-stranded RNA and regulates NF90-mediated gene expression independently of RNA editing.
15811368 2005 RNA binding and phosphorylation determine the intracellular distribution of nuclear factors 90 and 110.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15254228 2004 Nucleocytoplasmic shuttling of JAZ, a new cargo protein for exportin-5.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14654356 2003 Cell cycle dependent intracellular distribution of two spliced isoforms of TCP/ILF3 proteins.
14570900 2004 Minihelix-containing RNAs mediate exportin-5-dependent nuclear export of the double-stranded RNA-binding protein ILF3.
12946349 2003 Selective regulation of gene expression by nuclear factor 110, a member of the NF90 family of double-stranded RNA-binding proteins.
12504009 2002 Nuclear export of NF90 is required for interleukin-2 mRNA stabilization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
11958450 2002 Host cell proteins binding to the encapsidation signal epsilon in hepatitis B virus RNA.
11777942 2002 Exportin-5, a novel karyopherin, mediates nuclear export of double-stranded RNA binding proteins.
11739746 2002 The RNA binding protein nuclear factor 90 functions as both a positive and negative regulator of gene expression in mammalian cells.
11438540 2001 Nuclear factor 90 is a substrate and regulator of the eukaryotic initiation factor 2 kinase double-stranded RNA-activated protein kinase.
11438536 2001 Characterization of two evolutionarily conserved, alternatively spliced nuclear phosphoproteins, NFAR-1 and -2, that function in mRNA processing and interact with the double-stranded RNA-dependent protein kinase, PKR.
11167023 2000 Alternative splicing in the human interleukin enhancer binding factor 3 (ILF3) gene.
11161820 2001 The 90- and 110-kDa human NFAR proteins are translated from two differentially spliced mRNAs encoded on chromosome 19p13.
10749851 2000 Protein-arginine methyltransferase I, the predominant protein-arginine methyltransferase in cells, interacts with and is regulated by interleukin enhancer-binding factor 3.
10684936 2000 A new double-stranded RNA-binding protein that interacts with PKR.
10607473 1999 Molecular cloning and characterization of a translational inhibitory protein that binds to coding sequences of human acid beta-glucosidase and other mRNAs.
10574923 1999 Autoantibodies define a family of proteins with conserved double-stranded RNA-binding domains as well as DNA binding activity.
10400669 1999 DRBP76, a double-stranded RNA-binding nuclear protein, is phosphorylated by the interferon-induced protein kinase, PKR.
10320367 1999 Nuclear factor-90 of activated T-cells: A double-stranded RNA-binding protein and substrate for the double-stranded RNA-dependent protein kinase, PKR.
9843854 1998 CsA-sensitive purine-box transcriptional regulator in bronchial epithelial cells contains NF45, NF90, and Ku.
9620363 1998 Mapping interleukin enhancer binding factor 3 gene (ILF3) to human chromosome 19 (19q11-qter and 19p11-p13.1) by polymerase chain reaction amplification of human-rodent somatic cell hybrid DNA templates.
9442054 1998 DNA-dependent protein kinase interacts with antigen receptor response element binding proteins NF90 and NF45.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8885239 1996 Identification of novel M phase phosphoproteins by expression cloning.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
7519613 1994 Cloning and expression of cyclosporin A- and FK506-sensitive nuclear factor of activated T-cells: NF45 and NF90.
1438302 1992 A conserved double-stranded RNA-binding domain.