Property Summary

NCBI Gene PubMed Count 91
Grant Count 65
R01 Count 56
Funding $4,612,642.81
PubMed Score 135.80
PubTator Score 125.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.007 0.014
Multiple myeloma 1.823 0.000
ependymoma 1.700 0.000
oligodendroglioma 1.600 0.023
psoriasis -1.800 0.000
astrocytoma 1.500 0.004
glioblastoma 1.700 0.000
osteosarcoma -1.154 0.000
sonic hedgehog group medulloblastoma 2.900 0.000
atypical teratoid/rhabdoid tumor 2.500 0.000
medulloblastoma, large-cell 2.900 0.000
primitive neuroectodermal tumor 2.100 0.000
adrenocortical carcinoma 1.029 0.000
lung cancer 2.100 0.000
colon cancer 1.300 0.000
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma -1.320 0.008
lung adenocarcinoma 1.451 0.000
gastric carcinoma 1.200 0.027
ovarian cancer 2.700 0.000
dermatomyositis 1.300 0.001

Synonym

Accession Q12906 A8K6F2 G5E9M5 O43409 Q6P1X1 Q86XY7 Q99544 Q99545 Q9BZH4 Q9BZH5 Q9NQ95 Q9NQ96 Q9NQ97 Q9NQ98 Q9NQ99 Q9NQA0 Q9NQA1 Q9NQA2 Q9NRN2 Q9NRN3 Q9NRN4 Q9UMZ9 Q9UN00 Q9UN84 Q9UNA2
Symbols CBTF
DRBF
MMP4
MPP4
NF90
NFAR
NF110
NF90a
NF90b
NFAR2
TCP80
DRBP76
NF110b
NFAR-1
TCP110
MPHOSPH4
NF-AT-90

Gene

PDB

2L33   3P1X  

Gene RIF (61)

PMID Text
26891316 Deletion of the RNA binding domains of NF45 and NF90 diminished the enhancement of HIV infection and gene expression.
26795062 The NF90 C-terminus is involved in conformational changes in the protein after RNA binding.
26712564 These data suggest that, like ADAR2, underlying sequences in dsRNA may influence how NF90 recognizes its target RNAs
26491010 data suggest that lncRNA SALNR modulates cellular senescence at least partly through changing NF90 activity
26381409 The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators.
26273641 Taken together, our discovery of the function of TCP80 and RHA in regulating p53 IRES and p53 induction following DNA damage provides a better understanding of the mechanisms that regulate IRES-mediated p53 translation in response to genotoxic stress.
26240280 NF45 and NF90 are novel higher-eukaryote-specific factors required for the maturation of 60S ribosomal subunits.
25544776 Data indicate the role of cyclin-dependent kinase inhibitor 1A (p21) and interleukin enhancer binding factor 3 (ILF3) pathway in mediating the anti-leukemic activity of sodium dichloroacetate (DCA) in oncoprotein p53null leukemic cells.
25447144 the role of the human NF90 protein isoforms in DNA and RNA virus replication
25399696 Suppression of NF90 caused a decrease in the half-life of cyclin E1 mRNA
More...

AA Sequence

MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPE      1 - 70
DDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAAVT     71 - 140
EDKYEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEMEKVLAGETLSVNDPPDVLDRQKCLAALASL    141 - 210
RHAKWFQARANGLKSCVIVIRVLRDLCTRVPTWGPLRGWPLELLCEKSIGTANRPMGAGEALRRVLECLA    211 - 280
SGIVMPDGSGIYDPCEKEATDAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPKNE    281 - 350
NPVDYTVQIPPSTTYAITPMKRPMEEDGEEKSPSKKKKKIQKKEEKAEPPQAMNALMRLNQLKPGLQYKL    351 - 420
VSQTGPVHAPIFTMSVEVDGNSFEASGPSKKTAKLHVAVKVLQDMGLPTGAEGRDSSKGEDSAEETEAKP    421 - 490
AVVAPAPVVEAVSTPSAAFPSDATAEQGPILTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVE    491 - 560
VDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANKKKRAPVPVRGGPKFAAKPHNPGFGMGGPMH    561 - 630
NEVPPPPNLRGRGRGGSIRGRGRGRGFGGANHGGYMNAGAGYGSYGYGGNSATAGYSQFYSNGGHSGNAS    631 - 700
GGGGGGGGGSSGYGSYYQGDNYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPP    701 - 770
QGKQKGYNHGQGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGS    771 - 840
GGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNYQYR                    841 - 894
//

Text Mined References (104)

PMID Year Title
26891316 2016 NF45 and NF90 Bind HIV-1 RNA and Modulate HIV Gene Expression.
26795062 2016 Coordinated Action of Two Double-Stranded RNA Binding Motifs and an RGG Motif Enables Nuclear Factor 90 To Flexibly Target Different RNA Substrates.
26712564 2016 Nuclear factor 90 uses an ADAR2-like binding mode to recognize specific bases in dsRNA.
26491010 2015 Senescence-associated Long Non-coding RNA (SALNR) Delays Oncogene-induced Senescence through NF90 Regulation.
26381409 2015 The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators.
26273641 2015 Translational Control Protein 80 Stimulates IRES-Mediated Translation of p53 mRNA in Response to DNA Damage.
26240280 2015 The NF45/NF90 Heterodimer Contributes to the Biogenesis of 60S Ribosomal Subunits and Influences Nucleolar Morphology.
25544776 2015 The anti-leukemic activity of sodium dichloroacetate in p53mutated/null cells is mediated by a p53-independent ILF3/p21 pathway.
25447144 2015 NF90 isoforms, a new family of cellular proteins involved in viral replication?
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
More...