Property Summary

NCBI Gene PubMed Count 100
PubMed Score 146.52
PubTator Score 125.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma 1.029 4.7e-04
astrocytoma 1.100 8.7e-16
Astrocytoma, Pilocytic 1.200 2.5e-06
atypical teratoid / rhabdoid tumor 2.300 8.0e-11
colon cancer 1.300 3.0e-05
dermatomyositis 1.300 1.4e-03
ependymoma 1.400 1.0e-02
gastric carcinoma 1.200 2.7e-02
glioblastoma 1.700 1.7e-08
group 3 medulloblastoma 1.600 5.4e-03
lung adenocarcinoma 1.451 3.8e-07
lung cancer 1.300 6.7e-03
medulloblastoma, large-cell 2.900 1.8e-07
Multiple myeloma 1.073 1.9e-03
oligodendroglioma 1.600 2.3e-02
osteosarcoma -1.154 4.2e-04
ovarian cancer -1.300 4.8e-04
pediatric high grade glioma 1.600 6.0e-07
primitive neuroectodermal tumor 2.100 1.2e-07
psoriasis -1.800 1.2e-04
subependymal giant cell astrocytoma -1.302 1.9e-02
Waldenstrons macroglobulinemia 1.007 1.4e-02

Gene RIF (60)

AA Sequence

MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPE      1 - 70
DDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAAVT     71 - 140
EDKYEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEMEKVLAGETLSVNDPPDVLDRQKCLAALASL    141 - 210
RHAKWFQARANGLKSCVIVIRVLRDLCTRVPTWGPLRGWPLELLCEKSIGTANRPMGAGEALRRVLECLA    211 - 280
SGIVMPDGSGIYDPCEKEATDAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPKNE    281 - 350
NPVDYTVQIPPSTTYAITPMKRPMEEDGEEKSPSKKKKKIQKKEEKAEPPQAMNALMRLNQLKPGLQYKL    351 - 420
VSQTGPVHAPIFTMSVEVDGNSFEASGPSKKTAKLHVAVKVLQDMGLPTGAEGRDSSKGEDSAEETEAKP    421 - 490
AVVAPAPVVEAVSTPSAAFPSDATAEQGPILTKHGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVE    491 - 560
VDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANKKKRAPVPVRGGPKFAAKPHNPGFGMGGPMH    561 - 630
NEVPPPPNLRGRGRGGSIRGRGRGRGFGGANHGGYMNAGAGYGSYGYGGNSATAGYSQFYSNGGHSGNAS    631 - 700
GGGGGGGGGSSGYGSYYQGDNYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPP    701 - 770
QGKQKGYNHGQGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGS    771 - 840
GGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNYQYR                    841 - 894
//

Text Mined References (114)

PMID Year Title