Property Summary

NCBI Gene PubMed Count 46
Grant Count 35
R01 Count 33
Funding $2,421,314.51
PubMed Score 36.43
PubTator Score 31.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (26)

PMID Text
26891316 Deletion of the RNA binding domains of NF45 and NF90 diminished the enhancement of HIV infection and gene expression.
26381409 The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators.
26276310 NF45 overexpression is associated with poor prognosis and enhanced cell proliferation of pancreatic ductal adenocarcinoma.
26240280 NF45 and NF90 are novel higher-eukaryote-specific factors required for the maturation of 60S ribosomal subunits.
26059795 Upregulated expression of ILF2 in non-small cell lung cancer is associated with tumor cell proliferation and poor prognosis
25286760 These findings suggested that NF45 might play an important role in promoting the tumorigenesis of ESCC, and thus be a promising therapeutic target to prevent ESCC progression.
25023405 These findings indicate that NF45 plays an important role in the growth regulation of glioma cells
25010285 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 2 (ILF2, NF45), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
24920670 These results suggest a novel molecular mechanism for the modulation of RNA granule assembly and disassembly by NFAR2, NF45, and phosphorylation at double-stranded RNA-activated kinase PKR sites.
23129811 AU-rich 5' UTRs harboring internal ribosome entry sites are regulated by NF45. NF45 regulates XIAP protein levels through interaction with its IRES.
More...

AA Sequence

MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAE      1 - 70
QASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGN     71 - 140
KVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARW    141 - 210
FEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLF    211 - 280
LPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVI    281 - 350
VTPSEKAYEKPPEKKEGEEEEENTEEPPQGEEEESMETQE                                  351 - 390
//

Text Mined References (54)

PMID Year Title
26891316 2016 NF45 and NF90 Bind HIV-1 RNA and Modulate HIV Gene Expression.
26381409 2015 The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators.
26276310 2015 NF45 overexpression is associated with poor prognosis and enhanced cell proliferation of pancreatic ductal adenocarcinoma.
26240280 2015 The NF45/NF90 Heterodimer Contributes to the Biogenesis of 60S Ribosomal Subunits and Influences Nucleolar Morphology.
26059795 2015 Upregulated expression of ILF2 in non-small cell lung cancer is associated with tumor cell proliferation and poor prognosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25286760 2015 Expression and clinical role of NF45 as a novel cell cycle protein in esophageal squamous cell carcinoma (ESCC).
25023405 2014 Expression of NF45 correlates with malignant grade in gliomas and plays a pivotal role in tumor growth.
24920670 2014 RNA granule assembly and disassembly modulated by nuclear factor associated with double-stranded RNA 2 and nuclear factor 45.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...