Property Summary

NCBI Gene PubMed Count 51
PubMed Score 41.22
PubTator Score 31.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia 5.400 4.8e-02
acute quadriplegic myopathy 1.186 1.9e-06
astrocytoma 1.100 2.4e-02
atypical teratoid / rhabdoid tumor 1.100 5.5e-05
Breast cancer 1.400 4.8e-06
diabetes mellitus -1.400 2.7e-03
glioblastoma 1.300 4.9e-08
group 3 medulloblastoma 2.100 2.7e-05
invasive ductal carcinoma 1.200 1.2e-03
lung adenocarcinoma 2.207 2.5e-11
lung cancer 1.100 4.0e-02
medulloblastoma, large-cell 1.700 4.9e-07
mucosa-associated lymphoid tissue lympho... -1.505 1.5e-02
Multiple myeloma 2.563 6.7e-06
nasopharyngeal carcinoma 1.100 2.2e-03
non-small cell lung cancer 1.030 1.5e-22
ovarian cancer 2.500 5.1e-05
pediatric high grade glioma 1.300 6.6e-06
primitive neuroectodermal tumor 1.500 1.1e-05
Waldenstrons macroglobulinemia 1.238 1.2e-02

 MGI Phenotype (1)

Gene RIF (27)

AA Sequence

MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAE      1 - 70
QASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGN     71 - 140
KVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARW    141 - 210
FEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLF    211 - 280
LPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVI    281 - 350
VTPSEKAYEKPPEKKEGEEEEENTEEPPQGEEEESMETQE                                  351 - 390
//

Text Mined References (60)

PMID Year Title