Property Summary

NCBI Gene PubMed Count 22
PubMed Score 7.42
PubTator Score 7.55

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 2.5e-02

Gene RIF (7)

AA Sequence

MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPFKKENIRPVWQ      1 - 70
LASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLLCVMCRESREHRPHTAVLMEK     71 - 140
AAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQL    141 - 210
AKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVK    211 - 280
KKTGEFSDKLLSLQRGLREFQGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKSAYLHPQQ    281 - 350
FDCEPGVLGSKGFTWGKVYWEVEVEREGWSEDEEEGDEEEEGEEEEEEEEAGYGDGYDDWETDEDEESLG    351 - 420
DEEEEEEEEEEEVLESCMVGVARDSVKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAELFPALRPRRVG    421 - 490
IALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRLLLRP                         491 - 539
//

Text Mined References (25)

PMID Year Title