Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.20
PubTator Score 7.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 0.025

Gene RIF (6)

PMID Text
26043685 Down-regulation of TRIM26 is associated with worse prognosis of hepatocellular carcinoma.
22433715 In addition to confirming one of the top findings in the meta-analysis, TRIM26, RNF5 and HLA-DRB3 have been identified as potential candidate genes for schizophrenia.
22294275 The study reports no associations between polymorphisms in TRIM26 and the risk of aspirin-exacerbated respiratory disease in both logistic and regression analyses.
20593013 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
17713163 Higher baseline serum AFP levels independently predicted a lower sustained viral response to antivirals among patients with chronic hepatitis C.

AA Sequence

MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPFKKENIRPVWQ      1 - 70
LASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLLCVMCRESREHRPHTAVLMEK     71 - 140
AAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQL    141 - 210
AKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVK    211 - 280
KKTGEFSDKLLSLQRGLREFQGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKSAYLHPQQ    281 - 350
FDCEPGVLGSKGFTWGKVYWEVEVEREGWSEDEEEGDEEEEGEEEEEEEEAGYGDGYDDWETDEDEESLG    351 - 420
DEEEEEEEEEEEVLESCMVGVARDSVKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAELFPALRPRRVG    421 - 490
IALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRLLLRP                         491 - 539
//

Text Mined References (23)

PMID Year Title
26043685 2015 TRIM26 functions as a novel tumor suppressor of hepatocellular carcinoma and its downregulation contributes to worse prognosis.
25416956 2014 A proteome-scale map of the human interactome network.
24489884 2014 Genome-wide association study of proneness to anger.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23077300 2013 TRIM protein-mediated regulation of inflammatory and innate immune signaling and its association with antiretroviral activity.
22883433 2012 Genome-wide association study implicates HLA-C*01:02 as a risk factor at the major histocompatibility complex locus in schizophrenia.
22433715 2012 Expression QTL analysis of top loci from GWAS meta-analysis highlights additional schizophrenia candidate genes.
22294275 2012 Association study between TRIM26 polymorphisms and risk of aspirin-exacerbated respiratory disease.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...