Property Summary

NCBI Gene PubMed Count 8
PubMed Score 56.16
PubTator Score 29.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 5.6e-07
Disease Target Count Z-score Confidence
Dysplastic nevus syndrome 7 3.303 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 5.6e-07

Gene RIF (1)

AA Sequence

MQRALPGARQHLGAILASASVVVKALCAAVLFLYLLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQ      1 - 70
HVWDVAISLTTVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGAFAYLLTYMASFNLVYLFTVRIHGALG     71 - 140
FLGGVLVALKQTMGDCVVLRVPQVRVSVMPMLLLALLLLLRLATLLQSPALASYGFGLLSSWVYLRFYQR    141 - 210
HSRGRGDMADHFAFATFFPEILQPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDA    211 - 280
ERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPT    281 - 350
L//

Text Mined References (11)

PMID Year Title