Property Summary

NCBI Gene PubMed Count 56
PubMed Score 105.07
PubTator Score 75.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.100 3.7e-03
lung adenocarcinoma -2.200 4.2e-26
nephrosclerosis 1.053 8.8e-04
non-small cell lung cancer -1.270 4.3e-20
psoriasis 1.200 8.2e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (29)

AA Sequence

MRAGPGPTVTLALVLAVSWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAFDVQASPNEGF      1 - 70
VNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHYIRTQESAGLAVIDWEDWRPV     71 - 140
WVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFEFAAQQFMLETLRYVKAVRPRHLWGFYLFPD    141 - 210
CYNHDYVQNWESYTGRCPDVEVARNDQLAWLWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVAR    211 - 280
THHANHALPVYVFTRPTYSRRLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRL    281 - 350
LVPYVVNVSWATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDH    351 - 420
LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL                     421 - 473
//

Text Mined References (56)

PMID Year Title