Property Summary

NCBI Gene PubMed Count 53
Grant Count 38
R01 Count 24
Funding $4,608,727.37
PubMed Score 102.54
PubTator Score 75.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
nephrosclerosis 1.053 0.001
psoriasis 1.200 0.001
non-small cell lung cancer -1.270 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.004
lung adenocarcinoma -2.200 0.000

Gene RIF (26)

PMID Text
26453961 Data show that DNA methylation at CpG island of hyaluronoglucosaminidase 2 (HYLA2) could be used to identify stage II and III colon cancer patients who are most likely to benefit from 5-flourouracil chemotherapy with respect to progression-free survival.
26112095 High expression of S100P and HYAL2 is significantly associated with advanced disease and shorter survival of triple-negative breast cancer and S100P and HYAL2 could be potential prognostic markers of TNBC.
25864644 CD44 knock-down in bovine and human chondrocytes results in release of bound HYAL2.
25411425 Lower platelet HYAL2 levels and activity are associated with inflammatory bowel disease.
25232017 HYAL2 plays a redundant role in the catalysis of megadalton HA to its 20 kDa intermediate during fertilization.
25213452 A strong association between decreased HYAL2 methylation in peripheral blood and BC.
23560496 Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma.
21743962 HAS2-HYAL2/CD44 system may support spontaneous chemokinesis of human cancer cells through self-degradation of HMW-HA to produce LMW-HA by an autocrine mechanism.
20875124 Hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) in the accumulation of hyaluronan in endometrioid endometrial carcinoma
20864512 Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator)
More...

AA Sequence

MRAGPGPTVTLALVLAVSWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAFDVQASPNEGF      1 - 70
VNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHYIRTQESAGLAVIDWEDWRPV     71 - 140
WVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFEFAAQQFMLETLRYVKAVRPRHLWGFYLFPD    141 - 210
CYNHDYVQNWESYTGRCPDVEVARNDQLAWLWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVAR    211 - 280
THHANHALPVYVFTRPTYSRRLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRL    281 - 350
LVPYVVNVSWATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDH    351 - 420
LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL                     421 - 473
//

Text Mined References (53)

PMID Year Title
26453961 2015 Methylation status at HYAL2 predicts overall and progression-free survival of colon cancer patients under 5-FU chemotherapy.
26112095 2015 S100P and HYAL2 as prognostic markers for patients with triple-negative breast cancer.
25864644 2015 CD44 knock-down in bovine and human chondrocytes results in release of bound HYAL2.
25416956 2014 A proteome-scale map of the human interactome network.
25411425 2015 Platelet hyaluronidase-2: an enzyme that translocates to the surface upon activation to function in extracellular matrix degradation.
25232017 2014 Hyaluronidase 2: a novel germ cell hyaluronidase with epididymal expression and functional roles in mammalian sperm.
25213452 2015 DNA methylation array analyses identified breast cancer-associated HYAL2 methylation in peripheral blood.
23560496 2013 Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma.
21743962 2011 Fragmented hyaluronan is an autocrine chemokinetic motility factor supported by the HAS2-HYAL2/CD44 system on the plasma membrane.
21740893 2011 Hyal2 is a glycosylphosphatidylinositol-anchored, lipid raft-associated hyaluronidase.
More...