Property Summary

NCBI Gene PubMed Count 16
Grant Count 8
R01 Count 1
Funding $1,278,432.5
PubMed Score 179.17
PubTator Score 75.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
cutaneous lupus erythematosus -1.700 0.012
psoriasis -1.100 0.023

Gene RIF (9)

PMID Text
22028245 Decreased gene expression of MUC9 was found from colonic biopsies in patients with active and remission ulcerative colitis.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20130498 OVGP1 seems to detect a different spectrum of ovarian epithelial cancers than other markers and thus should be a useful adjunct for more accurate detection, particularly of early serous ovarian cancers and mucinous carcinomas.
18834073 Reflux laryngitis is associated with down-regulation of mucin gene expression.
16567366 Results suggests the binding of OGP to human sperm mediates through MYH9.
16209999 The presence of oviductin mRNA and protein has been determined in OE-E6/E7, an immortalized human oviductal epithelial cell line.
15585630 Gain of oviduct-specific glycoprotein is associated with the development of endometrial hyperplasia and endometrial cancer
12503889 The production and function of oviductin at different stages of human reproductive cycle is not well known. Its highest expression at the time of ovulation is consistent with a supportive role in fertilization and early embryo development.
11818519 cloning and characterization of the promoter and gene expression regulation in the oviduct (human oviduct-specific glycoprotein, HuOPG)

AA Sequence

MWKLLLWVGLVLVLKHHDGAAHKLVCYFTNWAHSRPGPASILPHDLDPFLCTHLIFAFASMNNNQIVAKD      1 - 70
LQDEKILYPEFNKLKERNRELKTLLSIGGWNFGTSRFTTMLSTFANREKFIASVISLLRTHDFDGLDLFF     71 - 140
LYPGLRGSPMHDRWTFLFLIEELLFAFRKEALLTMRPRLLLSAAVSGVPHIVQTSYDVRFLGRLLDFINV    141 - 210
LSYDLHGSWERFTGHNSPLFSLPEDPKSSAYAMNYWRKLGAPSEKLIMGIPTYGRTFRLLKASKNGLQAR    211 - 280
AIGPASPGKYTKQEGFLAYFEICSFVWGAKKHWIDYQYVPYANKGKEWVGYDNAISFSYKAWFIRREHFG    281 - 350
GAMVWTLDMDDVRGTFCGTGPFPLVYVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPERLAVTTAWTTD    351 - 420
SKILPPGGEAGVTEIHGKCENMTITPRGTTVTPTKETVSLGKHTVALGEKTEITGAMTMTSVGHQSMTPG    421 - 490
EKALTPVGHQSVTTGQKTLTSVGYQSVTPGEKTLTPVGHQSVTPVSHQSVSPGGTTMTPVHFQTETLRQN    491 - 560
TVAPRRKAVAREKVTVPSRNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQL    561 - 630
PEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEEA                          631 - 678
//

Text Mined References (17)

PMID Year Title
22028245 2012 Reduced expression of mucin 9 (MUC9) in patients with ulcerative colitis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20130498 2010 Oviductal glycoprotein (OVGP1, MUC9): a differentiation-based mucin present in serum of women with ovarian cancer.
18834073 2008 Mucin gene expression in human laryngeal epithelia: effect of laryngopharyngeal reflux.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16567366 2006 Identification and characterization of oviductal glycoprotein-binding protein partner on gametes: epitopic similarity to non-muscle myosin IIA, MYH 9.
16209999 2005 Expression of human oviductin in an immortalized human oviductal cell line.
15585630 2004 Gain of OGP, an estrogen-regulated oviduct-specific glycoprotein, is associated with the development of endometrial hyperplasia and endometrial cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...