Property Summary

NCBI Gene PubMed Count 96
Grant Count 140
R01 Count 95
Funding $16,518,138.11
PubMed Score 189.23
PubTator Score 261.86

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q12884 O00199 Q53TP5 Q86Z29 Q99998 Q9UID4
Symbols FAPA
SIMP
DPPIV
FAPalpha

Gene

FAP

PDB

1Z68  

Gene RIF (80)

PMID Text
27020681 Data suggest that a DNA vaccine targeting human fibroblast activation protein alpha (FAPalpha) may be an attractive and effective cancer immunotherapy strategy.
26962859 Human FGF-21 Is a Substrate of Fibroblast Activation Protein.
26934296 FAP selectively cleaves type I collagen resulting in increased macrophage adhesion.
26797127 This study identified fibroblast activation protein (FAP) as the enzyme that cleaves and inactivates human FGF21.
26635356 the circulating protease, fibroblast activation protein, is the proteolytic enzyme responsible for hFGF21 inactivation.
26621486 NPY is efficiently cleaved by FAP indicating a potential function for FAP in neuropeptide regulation within liver and cancer biology.
26454160 FAP is expressed by activated, collagen-synthesizing fibroblasts, but not by inactive fibroblasts or fully differentiated myofibroblasts and non-fibroblast cells in the infarct.
26342814 FAP sensitizes fibrosarcoma to chemotherapy and alters cell death.
26319660 In this study, we show for the first time the expression of FAP in activated fibroblasts after MI and its activation by TGFbeta1. Effects of FAP on fibroblast migration and gelatinolytic activity indicate a potential role in cardiac wound healing
26304112 degradomic study highlights cell-contextual proteolysis by FAPalpha with distinct positional profiles. Generally, our findings link FAPalpha to key aspects of CAF biology and attribute an important role in tumor-stroma interaction to FAPalpha
More...

AA Sequence

MKTWVKIVFGVATSAVLALLVMCIVLRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQ      1 - 70
SADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEF     71 - 140
VRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKY    141 - 210
ALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEV    211 - 280
PVPAMIASSDYYFSWLTWVTDERVCLQWLKRVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTGWAGGF    281 - 350
FVSTPVFSYDAISYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPG    351 - 420
RRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGRTDQEIKILEE    421 - 490
NKELENALKNIQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISY    491 - 560
LASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVS    561 - 630
SLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGT    631 - 700
ADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD              701 - 760
//

Text Mined References (107)

PMID Year Title
27020681 2016 Anti-tumor effects of DNA vaccine targeting human fibroblast activation protein ? by producing specific immune responses and altering tumor microenvironment in the 4T1 murine breast cancer model.
26962859 2016 Human FGF-21 Is a Substrate of Fibroblast Activation Protein.
26934296 2016 Cleavage of Type I Collagen by Fibroblast Activation Protein-? Enhances Class A Scavenger Receptor Mediated Macrophage Adhesion.
26797127 2016 Fibroblast Activation Protein Cleaves and Inactivates Fibroblast Growth Factor 21.
26635356 2016 Circulating FGF21 proteolytic processing mediated by fibroblast activation protein.
26621486 2016 Neuropeptide Y is a physiological substrate of fibroblast activation protein: Enzyme kinetics in blood plasma and expression of Y2R and Y5R in human liver cirrhosis and hepatocellular carcinoma.
26454160 2015 Has the search for a marker of activated fibroblasts finally come to an end?
26342814 2015 Integral membrane protease fibroblast activation protein sensitizes fibrosarcoma to chemotherapy and alters cell death mechanisms.
26319660 2015 Fibroblast activation protein alpha expression identifies activated fibroblasts after myocardial infarction.
26304112 2016 Fibroblast activation protein-?, a stromal cell surface protease, shapes key features of cancer associated fibroblasts through proteome and degradome alterations.
More...