Property Summary

Ligand Count 92
NCBI Gene PubMed Count 110
PubMed Score 226.21
PubTator Score 261.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma 1.819 3.7e-03
Breast cancer 3.000 2.3e-02
breast carcinoma 1.400 3.8e-04
cystic fibrosis 2.944 1.1e-06
Duchenne muscular dystrophy 1.222 2.2e-10
ependymoma 1.200 9.7e-04
gastric carcinoma 2.700 3.6e-02
interstitial cystitis 1.500 2.3e-02
intraductal papillary-mucinous adenoma (... -1.400 3.8e-02
invasive ductal carcinoma 1.280 3.2e-02
lung adenocarcinoma 1.600 4.3e-09
lung cancer 1.200 1.2e-02
malignant mesothelioma -6.800 4.9e-10
non-small cell lung cancer 2.256 2.4e-15
osteosarcoma 2.582 6.9e-03
ovarian cancer 1.900 1.8e-02
pancreatic cancer 1.200 1.2e-02
primary pancreatic ductal adenocarcinoma 2.024 9.9e-04
sonic hedgehog group medulloblastoma 1.900 3.1e-03
ulcerative colitis 1.400 1.2e-02

Gene RIF (94)

AA Sequence

MKTWVKIVFGVATSAVLALLVMCIVLRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQ      1 - 70
SADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEF     71 - 140
VRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKY    141 - 210
ALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEV    211 - 280
PVPAMIASSDYYFSWLTWVTDERVCLQWLKRVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTGWAGGF    281 - 350
FVSTPVFSYDAISYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPG    351 - 420
RRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGRTDQEIKILEE    421 - 490
NKELENALKNIQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISY    491 - 560
LASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVS    561 - 630
SLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGT    631 - 700
ADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD              701 - 760
//

Text Mined References (121)

PMID Year Title