Property Summary

NCBI Gene PubMed Count 188
PubMed Score 374.74
PubTator Score 861.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count
Malignant tumor of stomach 12
Disease Target Count P-value
lung carcinoma 2844 7.91287351012916E-15
Breast cancer 3099 5.16573254753287E-10
non-small cell lung cancer 2798 2.3766416829575E-9
ovarian cancer 8492 6.33486558152411E-9
tuberculosis 1563 1.98612125012245E-8
pilocytic astrocytoma 3086 2.96112609591269E-7
cystic fibrosis 1670 4.12124672686323E-7
posterior fossa group A ependymoma 1511 3.94805307583387E-6
chronic lymphosyte leukemia 232 4.59231969925173E-6
adult high grade glioma 2148 7.24738936634515E-6
malignant mesothelioma 3163 7.43435274225572E-6
lung cancer 4473 1.37868902409041E-5
ulcerative colitis 2087 2.56744435536593E-5
osteosarcoma 7933 1.37304537947791E-4
glioblastoma 5572 2.94095043288594E-4
adrenocortical carcinoma 1427 0.00573672426538437
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0108713303704632
active Crohn's disease 918 0.0114301145041735
colon cancer 1475 0.0146162764205124
aldosterone-producing adenoma 664 0.0228973840826468
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0376941951003836
atypical teratoid/rhabdoid tumor 1095 0.0419055891575464
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0450960277696201
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Bipolar Disorder 266 0.0 1.0
Schizophrenia 503 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 4.8 2.4
Diarrhea 155 4.01 2.0
Osteoporosis 259 3.673 1.8
Stomatitis 19 3.348 1.7

Expression

Synonym

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
C. elegans OMA EggNOG Inparanoid

 MGI Term (1)

Gene RIF (174)

PMID Text
26804235 This study demonstrates the clinical validity of combined MIR27A/DPYD screening to identify patients at risk of severe FP-toxicity.
26658227 Results suggest that DPYD c.1129-5923 C>G/hapB3 have limited predictive value for severe toxicity to 5-FU based combination chemotherapy.
26609109 Study shows that somatic mutations of DPYD cause a switch in pyrimidine metabolism and promote gene expression of pyrimidine enzymes toward malignant progression.
26603945 DPYD variants c.1679T>G and c.1236G>A/HapB3 are clinically relevant predictors of fluoropyrimidine-associated toxicity.
26372896 oxaliplatin-based chemotherapy increases ERCC1 and DPYD expression levels; bevacizumab induces VEGFA expression in metastatic colorectal cancer
26281864 Demonstrate a correlation between occurrence of DPYD gene variant c.496A>G and KRAS wild type status of colorectal cancer tissue.
26265346 We propose the gene activity score for translating DPYD genotype into phenotype--{REVIEW}
26265035 The relationship between DPD genotype and dihydrouracil/uracil values in the 22 patients of the present study was significant
25906447 The dihydropyrimidine dehydrogenase and ERCC1 expression profile could potentially serve as a useful prognostic biomarker and therapeutic target for surgically resected patients with ampullary carcinoma.
25873402 miR-494 is directly bound to DPYD 3'UTR and negatively regulated DPYD expression in colon cancer.
More...

AA Sequence

MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCFNCEKLENNFDDIKHTTLGER      1 - 70
GALREAMRCLKCADAPCQKSCPTNLDIKSFITSIANKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGC     71 - 140
NLYATEEGPINIGGLQQFATEVFKAMSIPQIRNPSLPPPEKMSEAYSAKIALFGAGPASISCASFLARLG    141 - 210
YSDITIFEKQEYVGGLSTSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSVNEMTLSTLKEKGYKAAF    211 - 280
IGIGLPEPNKDAIFQGLTQDQGFYTSKDFLPLVAKGSKAGMCACHSPLPSIRGVVIVLGAGDTAFDCATS    281 - 350
ALRCGARRVFIVFRKGFVNIRAVPEEMELAKEEKCEFLPFLSPRKVIVKGGRIVAMQFVRTEQDETGKWN    351 - 420
EDEDQMVHLKADVVISAFGSVLSDPKVKEALSPIKFNRWGLPEVDPETMQTSEAWVFAGGDVVGLANTTV    421 - 490
ESVNDGKQASWYIHKYVQSQYGASVSAKPELPLFYTPIDLVDISVEMAGLKFINPFGLASATPATSTSMI    491 - 560
RRAFEAGWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPMYGPGQSSFLNIELISEKTAAYWCQSVTELKA    561 - 630
DFPDNIVIASIMCSYNKNDWTELAKKSEDSGADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQ    631 - 700
AVQIPFFAKLTPNVTDIVSIARAAKEGGANGVTATNTVSGLMGLKSDGTPWPAVGIAKRTTYGGVSGTAI    701 - 770
RPIALRAVTSIARALPGFPILATGGIDSAESGLQFLHSGASVLQVCSAIQNQDFTVIEDYCTGLKALLYL    771 - 840
KSIEELQDWDGQSPATVSHQKGKPVPRIAELMDKKLPSFGPYLEQRKKIIAENKIRLKEQNVAFSPLKRN    841 - 910
CFIPKRPIPTIKDVIGKALQYLGTFGELSNVEQVVAMIDEEMCINCGKCYMTCNDSGYQAIQFDPETHLP    911 - 980
TITDTCTGCTLCLSVCPIVDCIKMVSRTTPYEPKRGVPLSVNPVC                             981 - 1025
//

Text Mined References (198)

PMID Year Title
26804235 2016 Rs895819 in MIR27A improves the predictive value of DPYD variants to identify patients at risk of severe fluoropyrimidine-associated toxicity.
26658227 2016 Association between DPYD c.1129-5923 C>G/hapB3 and severe toxicity to 5-fluorouracil-based chemotherapy in stage III colon cancer patients: NCCTG N0147 (Alliance).
26609109 2016 Hypermutation of DPYD Deregulates Pyrimidine Metabolism and Promotes Malignant Progression.
26603945 2015 Clinical relevance of DPYD variants c.1679T>G, c.1236G>A/HapB3, and c.1601G>A as predictors of severe fluoropyrimidine-associated toxicity: a systematic review and meta-analysis of individual patient data.
26372896 2015 Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study.
26281864 2016 Correlation between DPYD gene variation and KRAS wild type status in colorectal cancer.
26265346 2015 Translating DPYD genotype into DPD phenotype: using the DPYD gene activity score.
26265035 2016 Genotyping of a family with a novel deleterious DPYD mutation supports the pretherapeutic screening of DPD deficiency with dihydrouracil/uracil ratio.
25906447 2015 Prognostic Value of Excision Repair Cross-Complementing Gene 1, Dihydropyrimidine Dehydrogenase, and Human Equilibrative Nucleotide Transporter 1 Expression and Their Implications for Adjuvant Treatment in Patients With Ampullary Carcinoma.
25873402 2015 MicroRNA-494 sensitizes colon cancer cells to fluorouracil through regulation of DPYD.
More...