Property Summary

NCBI Gene PubMed Count 188
Grant Count 43
R01 Count 19
Funding $3,442,808.47
PubMed Score 374.74
PubTator Score 861.48

Knowledge Summary

Patent

No data available

Expression

 MGI Term (1)

Gene RIF (174)

PMID Text
26804235 This study demonstrates the clinical validity of combined MIR27A/DPYD screening to identify patients at risk of severe FP-toxicity.
26658227 Results suggest that DPYD c.1129-5923 C>G/hapB3 have limited predictive value for severe toxicity to 5-FU based combination chemotherapy.
26609109 Study shows that somatic mutations of DPYD cause a switch in pyrimidine metabolism and promote gene expression of pyrimidine enzymes toward malignant progression.
26603945 DPYD variants c.1679T>G and c.1236G>A/HapB3 are clinically relevant predictors of fluoropyrimidine-associated toxicity.
26372896 oxaliplatin-based chemotherapy increases ERCC1 and DPYD expression levels; bevacizumab induces VEGFA expression in metastatic colorectal cancer
26281864 Demonstrate a correlation between occurrence of DPYD gene variant c.496A>G and KRAS wild type status of colorectal cancer tissue.
26265346 We propose the gene activity score for translating DPYD genotype into phenotype--{REVIEW}
26265035 The relationship between DPD genotype and dihydrouracil/uracil values in the 22 patients of the present study was significant
25906447 The dihydropyrimidine dehydrogenase and ERCC1 expression profile could potentially serve as a useful prognostic biomarker and therapeutic target for surgically resected patients with ampullary carcinoma.
25873402 miR-494 is directly bound to DPYD 3'UTR and negatively regulated DPYD expression in colon cancer.
More...

AA Sequence

MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCFNCEKLENNFDDIKHTTLGER      1 - 70
GALREAMRCLKCADAPCQKSCPTNLDIKSFITSIANKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGC     71 - 140
NLYATEEGPINIGGLQQFATEVFKAMSIPQIRNPSLPPPEKMSEAYSAKIALFGAGPASISCASFLARLG    141 - 210
YSDITIFEKQEYVGGLSTSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSVNEMTLSTLKEKGYKAAF    211 - 280
IGIGLPEPNKDAIFQGLTQDQGFYTSKDFLPLVAKGSKAGMCACHSPLPSIRGVVIVLGAGDTAFDCATS    281 - 350
ALRCGARRVFIVFRKGFVNIRAVPEEMELAKEEKCEFLPFLSPRKVIVKGGRIVAMQFVRTEQDETGKWN    351 - 420
EDEDQMVHLKADVVISAFGSVLSDPKVKEALSPIKFNRWGLPEVDPETMQTSEAWVFAGGDVVGLANTTV    421 - 490
ESVNDGKQASWYIHKYVQSQYGASVSAKPELPLFYTPIDLVDISVEMAGLKFINPFGLASATPATSTSMI    491 - 560
RRAFEAGWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPMYGPGQSSFLNIELISEKTAAYWCQSVTELKA    561 - 630
DFPDNIVIASIMCSYNKNDWTELAKKSEDSGADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQ    631 - 700
AVQIPFFAKLTPNVTDIVSIARAAKEGGANGVTATNTVSGLMGLKSDGTPWPAVGIAKRTTYGGVSGTAI    701 - 770
RPIALRAVTSIARALPGFPILATGGIDSAESGLQFLHSGASVLQVCSAIQNQDFTVIEDYCTGLKALLYL    771 - 840
KSIEELQDWDGQSPATVSHQKGKPVPRIAELMDKKLPSFGPYLEQRKKIIAENKIRLKEQNVAFSPLKRN    841 - 910
CFIPKRPIPTIKDVIGKALQYLGTFGELSNVEQVVAMIDEEMCINCGKCYMTCNDSGYQAIQFDPETHLP    911 - 980
TITDTCTGCTLCLSVCPIVDCIKMVSRTTPYEPKRGVPLSVNPVC                             981 - 1025
//

Text Mined References (198)

PMID Year Title
26804235 2016 Rs895819 in MIR27A improves the predictive value of DPYD variants to identify patients at risk of severe fluoropyrimidine-associated toxicity.
26658227 2016 Association between DPYD c.1129-5923 C>G/hapB3 and severe toxicity to 5-fluorouracil-based chemotherapy in stage III colon cancer patients: NCCTG N0147 (Alliance).
26609109 2016 Hypermutation of DPYD Deregulates Pyrimidine Metabolism and Promotes Malignant Progression.
26603945 2015 Clinical relevance of DPYD variants c.1679T>G, c.1236G>A/HapB3, and c.1601G>A as predictors of severe fluoropyrimidine-associated toxicity: a systematic review and meta-analysis of individual patient data.
26372896 2015 Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study.
26281864 2016 Correlation between DPYD gene variation and KRAS wild type status in colorectal cancer.
26265346 2015 Translating DPYD genotype into DPD phenotype: using the DPYD gene activity score.
26265035 2016 Genotyping of a family with a novel deleterious DPYD mutation supports the pretherapeutic screening of DPD deficiency with dihydrouracil/uracil ratio.
25906447 2015 Prognostic Value of Excision Repair Cross-Complementing Gene 1, Dihydropyrimidine Dehydrogenase, and Human Equilibrative Nucleotide Transporter 1 Expression and Their Implications for Adjuvant Treatment in Patients With Ampullary Carcinoma.
25873402 2015 MicroRNA-494 sensitizes colon cancer cells to fluorouracil through regulation of DPYD.
More...