Property Summary

NCBI Gene PubMed Count 148
PubMed Score 1098.23
PubTator Score 401.02

Knowledge Summary

Patent (14,768)

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
psoriasis 6685 5.30050067105714E-31
oligodendroglioma 2849 9.54178887844968E-17
lung carcinoma 2844 1.24796834934728E-15
pilocytic astrocytoma 3086 8.27950811410616E-10
pediatric high grade glioma 2712 2.15788288233661E-8
glioblastoma 5572 6.31543820756943E-8
group 4 medulloblastoma 1875 1.01013903201177E-6
medulloblastoma, large-cell 6234 3.9562861898874E-6
atypical teratoid / rhabdoid tumor 4369 9.7395994750702E-6
primitive neuroectodermal tumor 3031 3.13969209002749E-5
astrocytic glioma 2241 7.79310686934712E-4
ependymoma 2514 0.00115590549254368
ovarian cancer 8492 0.00607024790610714
subependymal giant cell astrocytoma 2287 0.0321705213862981
Pick disease 1893 0.0358725595319218
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Melanoma 261 0.0 1.0
Skin cancer 37 0.0 1.0
Disease Target Count Z-score Confidence
Hepatitis B 103 0.0 2.0
Rheumatoid Arthritis 1171 0.0 1.0

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -3.200 0.001
oligodendroglioma -3.300 0.000
glioblastoma -5.600 0.000
ependymoma -1.900 0.001
group 4 medulloblastoma -4.800 0.000
atypical teratoid / rhabdoid tumor -3.300 0.000
medulloblastoma, large-cell -4.400 0.000
primitive neuroectodermal tumor -5.100 0.000
pediatric high grade glioma -4.900 0.000
pilocytic astrocytoma -4.600 0.000
subependymal giant cell astrocytoma -1.801 0.032
lung carcinoma 2.500 0.000
Pick disease -1.100 0.036
ovarian cancer -2.200 0.006
psoriasis -1.500 0.000

Synonym

Accession Q12879 O00669 Q17RZ6 GluN2A
Symbols LKS
EPND
FESD
NR2A
GluN2A
NMDAR2A

Gene

PDB

3NFL   5H8F   5H8H   5H8N   5H8Q   5I2K   5I2N   5KCJ   5KDT  

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid

  TechDev Info (1)

Susumu Tomita Examining potential modulators

Gene RIF (125)

PMID Text
26584860 Knockdown of PKD1 did not affect NMDAR internalization but prevented the phosphorylation and inhibition of remaining surface NMDARs and NMDAR-mediated synaptic functions.
26502998 To determine genetic variability within the N-methyl-D-aspartate receptor 2A sub-unit (GRIN2A) gene promoter and its association with concussion recovery time.
26220384 Findings suggest that mutations in GRIN2A preferentially are involved in genetic variance of pediatric idiopathic generalized epilepsy and do not contribute significantly to either adult focal epilepsies as temporal lobe epilepsy or generalized epilepsies
25958346 GRIN2A (GT)21 may play a significant role in the etiology of schizophrenia among the Chinese Han population of Shaanxi.
25788577 NMDARs have a dual role during erythropoiesis, supporting survival of polychromatic erythroblasts and contributing to the Ca(2+) homeostasis from the orthochromatic erythroblast stage to circulating red blood cells.
25760043 Ca(2+) influx through the NMDA receptor is necessary for HIV-1 Tat-induced synapse loss
25596506 Dysarthria and dyspraxia are found in individuals with GRIN2A mutations, often in the setting of epilepsy-aphasia syndromes. The speech phenotype may occur in the absence of a seizure disorder, reinforcing the role for GRIN2A in motor speech function.
25412286 Based on large, well-characterized datasets independent from the original study, our results are not in favor of an interaction between caffeinated coffee consumption and GRIN2A rs4998386 for Parkinson disease risk
25366762 GRIN2A gene polymorphisms confer susceptibility to heroin addiction.
25261450 Study found GluN receptor subunit-specific changes in mixed subcortical ischemic vascular dementia(SIVD)/Alzheimer's disease(AD) (decreased GluN1) and SIVD (increased GluN2A and 2B), likely reflecting interaction of ischemic neurovascular and AD processes
More...

AA Sequence

MGRVGYWTLLVLPALLVWRGPAPSAAAEKGPPALNIAVMLGHSHDVTERELRTLWGPEQAAGLPLDVNVV      1 - 70
ALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSHTFVPILGIHGGASMIMADKDP     71 - 140
TSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGYREFISFVKTTVDNSFVGWDMQNVITLDTSF    141 - 210
EDAKTQVQLKKIHSSVILLYCSKDEAVLILSEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVS    211 - 280
YDDWDYSLEARVRDGIGILTTAASSMLEKFSYIPEAKASCYGQMERPEVPMHTLHPFMVNVTWDGKDLSF    281 - 350
TEEGYQVHPRLVVIVLNKDREWEKVGKWENHTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE    351 - 420
DIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVN    421 - 490
NVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVM    491 - 560
MFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIM    561 - 630
VSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPY    631 - 700
MHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSP    701 - 770
WKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHL    771 - 840
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRSAKNISSMSNM    841 - 910
NSSRMDSPKRAADFIQRGSLIMDMVSDKGNLMYSDNRSFQGKESIFGDNMNELQTFVANRQKDNLNNYVF    911 - 980
QGQHPLTLNESNPNTVEVAVSTESKANSRPRQLWKKSVDSIRQDSLSQNPVSQRDEATAENRTHSLKSPR    981 - 1050
YLPEEMAHSDISETSNRATCHREPDNSKNHKTKDNFKRSVASKYPKDCSEVERTYLKTKSSSPRDKIYTI   1051 - 1120
DGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDSTLPMNRNPLHNEEGLSNNDQYKLYSKH   1121 - 1190
FTLKDKGSPHSETSERYRQNSTHCRSCLSNMPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNP   1191 - 1260
ATGEQVYQQDWAQNNALQLQKNKLRISRQHSYDNIVDKPRELDLSRPSRSISLKDRERLLEGNFYGSLFS   1261 - 1330
VPSSKLSGKKSSLFPQGLEDSKRSKSLLPDHTSDNPFLHSHRDDQRLVIGRCPSDPYKHSLPSQAVNDSY   1331 - 1400
LRSSLRSTASYCSRDSRGHNDVYISEHVMPYAANKNNMYSTPRVLNSCSNRRVYKKMPSIESDV         1401 - 1464
//

Text Mined References (154)

PMID Year Title
26584860 2015 Regulated internalization of NMDA receptors drives PKD1-mediated suppression of the activity of residual cell-surface NMDA receptors.
26502998 2015 Association between GRIN2A promoter polymorphism and recovery from concussion.
26220384 2015 Investigation of GRIN2A in common epilepsy phenotypes.
25958346 2015 Correlation of functional GRIN2A gene promoter polymorphisms with schizophrenia and serum D-serine levels.
25788577 2015 Functional plasticity of the N-methyl-d-aspartate receptor in differentiating human erythroid precursor cells.
25596506 2015 GRIN2A: an aptly named gene for speech dysfunction.
25412286 2014 Lack of replication of the GRIN2A-by-coffee interaction in Parkinson disease.
25366762 2014 Functional polymorphisms of the glutamate receptor N-methyl D-aspartate 2A gene are associated with heroin addiction.
25261450 2015 Differential alterations of neocortical GluN receptor subunits in patients with mixed subcortical ischemic vascular dementia and Alzheimer's disease.
25194280 2014 Genome-wide association study identifies three susceptibility loci for laryngeal squamous cell carcinoma in the Chinese population.
More...