Property Summary

NCBI Gene PubMed Count 148
Grant Count 451
R01 Count 248
Funding $48,455,213.37
PubMed Score 1098.23
PubTator Score 401.02

Knowledge Summary

Patent (14,768)

TINX Plot

  Disease Relevance (56)

Disease Z-score Confidence
Schizophrenia 501 5.19 2.6
Epilepsy 346 5.081 2.5
Toxic encephalopathy 131 5.04 2.5
Brain Ischemia 87 4.104 2.1
Alzheimer's disease 644 3.752 1.9
Alcohol dependence 107 3.481 1.7
Cerebrovascular disease 231 3.446 1.7
Parkinson's disease 364 3.325 1.7
Fetal alcohol syndrome 10 3.26 1.6
Aphasia 22 3.258 1.6
Bipolar Disorder 266 3.232 1.6
Huntington's disease 72 3.174 1.6
Autistic Disorder 320 3.08 1.5
High pressure neurological syndrome 9 3.078 1.5
Opiate dependence 12 3.0 1.5
Alcoholism 14
Arteriosclerotic Parkinsonism 8
Carcinoma 2,147 1.0
Colorectal Neoplasms 217
EPILEPSY, FOCAL, WITH SPEECH DISORDER AN... 1 
Epilepsy, Rolandic 1
Extrapyramidal disease 8
General anesthesia 53
Hepatitis B 103 2.0
Influenza A Prevention 7
Influenza due to Influenza A virus 7
Landau-Kleffner Syndrome 3
Language Development Disorders 9
Lennox-Gastaut syndrome 34
Local anesthesia 40
Melanoma 261 1.0
Moderate to Severe Alzheimer's Type Deme... 5 
Morphine dependence 19
Parkinsonism 19
Pick disease 1,893
Postencephalitic parkinsonism 12
Rheumatoid Arthritis 1,160 1.0
Rolandic Epilepsy, Mental Retardation, A... 1 
Simple partial seizure 26
Skin cancer 37 1.0
Speech Disorders 3
Substance Withdrawal Syndrome 52
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
ependymoma 2,514
glioblastoma 5,572
group 4 medulloblastoma 1,875
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
oligodendroglioma 2,849
ovarian cancer 8,484
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
primitive neuroectodermal tumor 3,031
psoriasis 6,685
subependymal giant cell astrocytoma 2,287

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -3.200 0.001
oligodendroglioma -3.300 0.000
glioblastoma -5.600 0.000
ependymoma -1.900 0.001
group 4 medulloblastoma -4.800 0.000
atypical teratoid / rhabdoid tumor -3.300 0.000
medulloblastoma, large-cell -4.400 0.000
primitive neuroectodermal tumor -5.100 0.000
pediatric high grade glioma -4.900 0.000
pilocytic astrocytoma -4.600 0.000
subependymal giant cell astrocytoma -1.801 0.032
lung carcinoma 2.500 0.000
Pick disease -1.100 0.036
ovarian cancer -2.200 0.006
psoriasis -1.500 0.000

Synonym

Accession Q12879 O00669 Q17RZ6 GluN2A
Symbols LKS
EPND
FESD
NR2A
GluN2A
NMDAR2A

Gene

PDB

3NFL   5H8F   5H8H   5H8N   5H8Q   5I2K   5I2N   5KCJ   5KDT  

  TechDev Info (1)

Susumu Tomita Examining potential modulators

Gene RIF (132)

PMID Text
26584860 Knockdown of PKD1 did not affect NMDAR internalization but prevented the phosphorylation and inhibition of remaining surface NMDARs and NMDAR-mediated synaptic functions.
26502998 To determine genetic variability within the N-methyl-D-aspartate receptor 2A sub-unit (GRIN2A) gene promoter and its association with concussion recovery time.
26220384 Findings suggest that mutations in GRIN2A preferentially are involved in genetic variance of pediatric idiopathic generalized epilepsy and do not contribute significantly to either adult focal epilepsies as temporal lobe epilepsy or generalized epilepsies
25958346 GRIN2A (GT)21 may play a significant role in the etiology of schizophrenia among the Chinese Han population of Shaanxi.
25788577 NMDARs have a dual role during erythropoiesis, supporting survival of polychromatic erythroblasts and contributing to the Ca(2+) homeostasis from the orthochromatic erythroblast stage to circulating red blood cells.
25760043 Ca(2+) influx through the NMDA receptor is necessary for HIV-1 Tat-induced synapse loss
25596506 Dysarthria and dyspraxia are found in individuals with GRIN2A mutations, often in the setting of epilepsy-aphasia syndromes. The speech phenotype may occur in the absence of a seizure disorder, reinforcing the role for GRIN2A in motor speech function.
25412286 Based on large, well-characterized datasets independent from the original study, our results are not in favor of an interaction between caffeinated coffee consumption and GRIN2A rs4998386 for Parkinson disease risk
25366762 GRIN2A gene polymorphisms confer susceptibility to heroin addiction.
25261450 Study found GluN receptor subunit-specific changes in mixed subcortical ischemic vascular dementia(SIVD)/Alzheimer's disease(AD) (decreased GluN1) and SIVD (increased GluN2A and 2B), likely reflecting interaction of ischemic neurovascular and AD processes
More...

AA Sequence

MGRVGYWTLLVLPALLVWRGPAPSAAAEKGPPALNIAVMLGHSHDVTERELRTLWGPEQAAGLPLDVNVV      1 - 70
ALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSHTFVPILGIHGGASMIMADKDP     71 - 140
TSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGYREFISFVKTTVDNSFVGWDMQNVITLDTSF    141 - 210
EDAKTQVQLKKIHSSVILLYCSKDEAVLILSEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVS    211 - 280
YDDWDYSLEARVRDGIGILTTAASSMLEKFSYIPEAKASCYGQMERPEVPMHTLHPFMVNVTWDGKDLSF    281 - 350
TEEGYQVHPRLVVIVLNKDREWEKVGKWENHTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE    351 - 420
DIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVN    421 - 490
NVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVM    491 - 560
MFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIM    561 - 630
VSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPY    631 - 700
MHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSP    701 - 770
WKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHL    771 - 840
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRSAKNISSMSNM    841 - 910
NSSRMDSPKRAADFIQRGSLIMDMVSDKGNLMYSDNRSFQGKESIFGDNMNELQTFVANRQKDNLNNYVF    911 - 980
QGQHPLTLNESNPNTVEVAVSTESKANSRPRQLWKKSVDSIRQDSLSQNPVSQRDEATAENRTHSLKSPR    981 - 1050
YLPEEMAHSDISETSNRATCHREPDNSKNHKTKDNFKRSVASKYPKDCSEVERTYLKTKSSSPRDKIYTI   1051 - 1120
DGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDSTLPMNRNPLHNEEGLSNNDQYKLYSKH   1121 - 1190
FTLKDKGSPHSETSERYRQNSTHCRSCLSNMPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNP   1191 - 1260
ATGEQVYQQDWAQNNALQLQKNKLRISRQHSYDNIVDKPRELDLSRPSRSISLKDRERLLEGNFYGSLFS   1261 - 1330
VPSSKLSGKKSSLFPQGLEDSKRSKSLLPDHTSDNPFLHSHRDDQRLVIGRCPSDPYKHSLPSQAVNDSY   1331 - 1400
LRSSLRSTASYCSRDSRGHNDVYISEHVMPYAANKNNMYSTPRVLNSCSNRRVYKKMPSIESDV         1401 - 1464
//

Text Mined References (154)

PMID Year Title
26584860 2015 Regulated internalization of NMDA receptors drives PKD1-mediated suppression of the activity of residual cell-surface NMDA receptors.
26502998 2015 Association between GRIN2A promoter polymorphism and recovery from concussion.
26220384 2015 Investigation of GRIN2A in common epilepsy phenotypes.
25958346 2015 Correlation of functional GRIN2A gene promoter polymorphisms with schizophrenia and serum D-serine levels.
25788577 2015 Functional plasticity of the N-methyl-d-aspartate receptor in differentiating human erythroid precursor cells.
25596506 2015 GRIN2A: an aptly named gene for speech dysfunction.
25412286 2014 Lack of replication of the GRIN2A-by-coffee interaction in Parkinson disease.
25366762 2014 Functional polymorphisms of the glutamate receptor N-methyl D-aspartate 2A gene are associated with heroin addiction.
25261450 2015 Differential alterations of neocortical GluN receptor subunits in patients with mixed subcortical ischemic vascular dementia and Alzheimer's disease.
25194280 2014 Genome-wide association study identifies three susceptibility loci for laryngeal squamous cell carcinoma in the Chinese population.
More...