Property Summary

NCBI Gene PubMed Count 35
PubMed Score 20.12
PubTator Score 9.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 4.3e-07
ovarian cancer 8520 1.5e-05
diabetes mellitus 1728 1.2e-03
astrocytoma 1146 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.100 1.9e-03
diabetes mellitus -1.300 1.2e-03
malignant mesothelioma 1.700 4.3e-07
ovarian cancer 1.700 1.5e-05

Gene RIF (5)

AA Sequence

METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKE      1 - 70
ELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYL     71 - 140
DLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELF    141 - 210
GKIQAEFEKKWENGTFPGWPKETSSALTHAGAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEE    211 - 280
RAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDIAFLEAQIYEYVEILGEQRHLTHENVQRKQA    281 - 350
RTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPK    351 - 420
AFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKK    421 - 490
TYEDLKRQGLL                                                               491 - 501
//

Text Mined References (46)

PMID Year Title