Property Summary

NCBI Gene PubMed Count 40
Grant Count 21
R01 Count 13
Funding $2,731,340.24
PubMed Score 82.77
PubTator Score 65.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.857 0.000
posterior fossa group B ependymoma -1.600 0.000
glioblastoma -1.500 0.002
adult high grade glioma -1.500 0.000

 GWAS Trait (2)

Gene RIF (9)

PMID Text
26551667 Mutations in CHD3 gene is associated with cutaneous T cell lymphoma and Sezary syndrome.
26362536 HIV-1 Gag interacts with CHD3 as demonstrated by proximity dependent biotinylation proteomics
25533843 CHD3.1 and ACF1-SNF2H display counteractive activities but similar histone affinities.
25213355 CHD3 was confirmed to interact with NES1 in NS2, and a disruption to this interaction by mutation in NES1 significantly delayed viral vRNPs export and viral propagation.
24425734 In this study, the chromatin remodeler chromodomain helicase DNA binding (CHD3) protein is identified as an important component of the initial repression of the herpesvirus genome.
22140357 HIV-1 Gag interacts with CHD3 as demonstrated by proximity dependent biotinylation proteomics
18922793 UV radiation regulates Mi-2 through protein translation and stability
17626165 Pericentrin forms complexes with CHD3 and CHD4, but a distinct CHD3-pericentrin complex is required for centrosomal anchoring of pericentrin/gamma-tubulin and for centrosome integrity.
17489097 effect of progressive C-terminal deletions of CHD3, which indicated that sequences required for repression of PS1 lie between amino acids 1955 and 1877

AA Sequence

MKAADTVILWARSKNDQLRISFPPGLCWGDRMPDKDDIRLLPSALGVKKRKRGPKKQKENKPGKPRKRKK      1 - 70
RDSEEEFGSERDEYREKSESGGSEYGTGPGRKRRRKHREKKEKKTKRRKKGEGDGGQKQVEQKSSATLLL     71 - 140
TWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKIPMSKMMTILGAKWREFSANNPFKGSAAAVA    141 - 210
AAAAAAAAAVAEQVSAAVSSATPIAPSGPPALPPPPAADIQPPPIRRAKTKEGKGPGHKRRSKSPRVPDG    211 - 280
RKKLRGKKMAPLKIKLGLLGGKRKKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGPVRTKKLKRG    281 - 350
RPGRKKKKVLGCPAVAGEEEVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSC    351 - 420
PHCEKEGVQWEAKEEEEEYEEEGEEEGEKEEEDDHMEYCRVCKDGGELLCCDACISSYHIHCLNPPLPDI    421 - 490
PNGEWLCPRCTCPVLKGRVQKILHWRWGEPPVAVPAPQQADGNPDVPPPRPLQGRSEREFFVKWVGLSYW    491 - 560
HCSWAKELQLEIFHLVMYRNYQRKNDMDEPPPLDYGSGEDDGKSDKRKVKDPHYAEMEEKYYRFGIKPEW    561 - 630
MTVHRIINHSVDKKGNYHYLVKWRDLPYDQSTWEEDEMNIPEYEEHKQSYWRHRELIMGEDPAQPRKYKK    631 - 700
KKKELQGDGPPSSPTNDPTVKYETQPRFITATGGTLHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQ    701 - 770
TIVFLYSLYKEGHTKGPFLVSAPLSTIINWEREFQMWAPKFYVVTYTGDKDSRAIIRENEFSFEDNAIKG    771 - 840
GKKAFKMKREAQVKFHVLLTSYELITIDQAALGSIRWACLVVDEAHRLKNNQSKFFRVLNGYKIDHKLLL    841 - 910
TGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKT    911 - 980
ELIVRVELSPMQKKYYKYILTRNFEALNSRGGGNQVSLLNIMMDLKKCCNHPYLFPVAAMESPKLPSGAY    981 - 1050
EGGALIKSSGKLMLLQKMLRKLKEQGHRVLIFSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAID   1051 - 1120
RFNAPGAQQFCFLLSTRAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASV   1121 - 1190
EERITQVAKRKMMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKDENEGENKEEDSSVIHYDNEAI   1191 - 1260
ARLLDRNQDATEDTDVQNMNEYLSSFKVAQYVVREEDKIEEIEREIIKQEENVDPDYWEKLLRHHYEQQQ   1261 - 1330
EDLARNLGKGKRVRKQVNYNDAAQEDQDNQSEYSVGSEEEDEDFDERPEGRRQSKRQLRNEKDKPLPPLL   1331 - 1400
ARVGGNIEVLGFNTRQRKAFLNAVMRWGMPPQDAFTTQWLVRDLRGKTEKEFKAYVSLFMRHLCEPGADG   1401 - 1470
SETFADGVPREGLSRQQVLTRIGVMSLVKKKVQEFEHINGRWSMPELMPDPSADSKRSSRASSPTKTSPT   1471 - 1540
TPEASATNSPCTSKPATPAPSEKGEGIRTPLEKEEAENQEEKPEKNSRIGEKMETEADAPSPAPSLGERL   1541 - 1610
EPRKIPLEDEVPGVPGEMEPEPGYRGDREKSATESTPGERGEEKPLDGQEHRERPEGETGDLGKREDVKG   1611 - 1680
DRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWHRRHDYWLLA   1681 - 1750
GIVLHGYARWQDIQNDAQFAIINEPFKTEANKGNFLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNLSQ   1751 - 1820
EPAHPAMALHARFAEAECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPATLSRIP   1821 - 1890
PIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFIT   1891 - 1960
AATNGPPVLVKKEKEMVGALVSDGLDRKEPRAGEVICIDD                                 1961 - 2000
//

Text Mined References (51)

PMID Year Title
26551667 2015 The mutational landscape of cutaneous T cell lymphoma and Sézary syndrome.
25533843 2014 Opposing ISWI- and CHD-class chromatin remodeling activities orchestrate heterochromatic DNA repair.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25213355 2015 CHD3 facilitates vRNP nuclear export by interacting with NES1 of influenza A virus NS2.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24425734 2014 Epigenetic repression of herpes simplex virus infection by the nucleosome remodeler CHD3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...