Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.82
PubTator Score 17.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 4.85306354255419E-6
Pick disease 1893 1.00250628444251E-5
psoriasis 6685 6.42242928117229E-5
malignant mesothelioma 3163 2.84694579561411E-4
osteosarcoma 7933 0.00112187215241602
Gaucher disease type 1 171 0.0180550680805242

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -2.700 0.000
osteosarcoma 1.114 0.001
Pick disease -1.300 0.000
ovarian cancer 1.300 0.000
Gaucher disease type 1 -1.300 0.018

Synonym

Accession Q12872 B2RN45 B7ZM97 F5H6B8 Q6PJF7
Symbols SWAP
SFRS8

Gene

PDB

2E5Z   2E60  

  Ortholog (14)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDERALAQEQGQHLIPWMGDHKIL      1 - 70
IDRYDGRGHLHDLSEYDAEYSTWNRDYQLSEEEARIEALCDEERYLALHTDLLEEEARQEEEYKRLSEAL     71 - 140
AEDGSYNAVGFTYGSDYYDPSEPTEEEEPSKQREKNEAENLEENEEPFVAPLGLSVPSDVELPPTAKMHA    141 - 210
IIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSG    211 - 280
VSSDNEDDDDEEDGNYLHPSLFASKKCNRLEELMKPLKVVDPDHPLAALVRKAQADSSTPTPHNADGAPV    281 - 350
QPSQVEYTADSTVAAMYYSYYMLPDGTYCLAPPPPGIDVTTYYSTLPAGVTVSNSPGVTTTAPPPPGTTP    351 - 420
LPPPTTAETSSGATSTTTTTSALAPVAAIIPPPPDVQPVIDKLAEYVARNGLKFETSVRAKNDQRFEFLQ    421 - 490
PWHQYNAYYEFKKQFFLQKEGGDSMQAVSAPEEAPTDSAPEKPSDAGEDGAPEDAAEVGARAGSGGKKEA    491 - 560
SSSKTVPDGKLVKASFAPISFAIKAKENDLLPLEKNRVKLDDDSDDDEESKEGQESSSSAANTNPAVAPP    561 - 630
CVVVEEKKPQLTQEELEAKQAKQKLEDRLAAAAREKLAQASKESKEKQLQAERKRKAALFLQTLKNPLPE    631 - 700
AEAGKIEESPFSVEESSTTPCPLLTGGRPLPTLEVKPPDRPSSKSKDPPREEEKEKKKKKHKKRSRTRSR    701 - 770
SPKYHSSSKSRSRSHSKAKHSLPSAYRTVRRSRSRSRSPRRRAHSPERRREERSVPTAYRVSRSPGASRK    771 - 840
RTRSRSPHEKKKKRRSRSRTKSKARSQSVSPSKQAAPRPAAPAAHSAHSASVSPVESRGSSQERSRGVSQ    841 - 910
EKEAQISSAIVSSVQSKITQDLMAKVRAMLAASKNLQTSAS                                 911 - 951
//

Text Mined References (20)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...