Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.82
PubTator Score 17.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Autism spectrum disorder 101 0.0 0.0
Disease Target Count
Autism Spectrum Disorders 75
Disease Target Count P-value
Pick disease 1894 1.0e-05
psoriasis 6694 6.4e-05
ovarian cancer 8520 2.5e-04
malignant mesothelioma 3232 2.8e-04
osteosarcoma 7950 1.1e-03
Gaucher disease type 1 180 1.8e-02

Expression

  Differential Expression (6)

Disease log2 FC p
Gaucher disease type 1 -1.300 1.8e-02
malignant mesothelioma 1.100 2.8e-04
osteosarcoma 1.114 1.1e-03
ovarian cancer 1.100 2.5e-04
Pick disease -1.300 1.0e-05
psoriasis -2.700 6.4e-05

Gene RIF (1)

AA Sequence

MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGYACKLFRDDERALAQEQGQHLIPWMGDHKIL      1 - 70
IDRYDGRGHLHDLSEYDAEYSTWNRDYQLSEEEARIEALCDEERYLALHTDLLEEEARQEEEYKRLSEAL     71 - 140
AEDGSYNAVGFTYGSDYYDPSEPTEEEEPSKQREKNEAENLEENEEPFVAPLGLSVPSDVELPPTAKMHA    141 - 210
IIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSG    211 - 280
VSSDNEDDDDEEDGNYLHPSLFASKKCNRLEELMKPLKVVDPDHPLAALVRKAQADSSTPTPHNADGAPV    281 - 350
QPSQVEYTADSTVAAMYYSYYMLPDGTYCLAPPPPGIDVTTYYSTLPAGVTVSNSPGVTTTAPPPPGTTP    351 - 420
LPPPTTAETSSGATSTTTTTSALAPVAAIIPPPPDVQPVIDKLAEYVARNGLKFETSVRAKNDQRFEFLQ    421 - 490
PWHQYNAYYEFKKQFFLQKEGGDSMQAVSAPEEAPTDSAPEKPSDAGEDGAPEDAAEVGARAGSGGKKEA    491 - 560
SSSKTVPDGKLVKASFAPISFAIKAKENDLLPLEKNRVKLDDDSDDDEESKEGQESSSSAANTNPAVAPP    561 - 630
CVVVEEKKPQLTQEELEAKQAKQKLEDRLAAAAREKLAQASKESKEKQLQAERKRKAALFLQTLKNPLPE    631 - 700
AEAGKIEESPFSVEESSTTPCPLLTGGRPLPTLEVKPPDRPSSKSKDPPREEEKEKKKKKHKKRSRTRSR    701 - 770
SPKYHSSSKSRSRSHSKAKHSLPSAYRTVRRSRSRSRSPRRRAHSPERRREERSVPTAYRVSRSPGASRK    771 - 840
RTRSRSPHEKKKKRRSRSRTKSKARSQSVSPSKQAAPRPAAPAAHSAHSASVSPVESRGSSQERSRGVSQ    841 - 910
EKEAQISSAIVSSVQSKITQDLMAKVRAMLAASKNLQTSAS                                 911 - 951
//

Text Mined References (21)

PMID Year Title