Property Summary

NCBI Gene PubMed Count 94
Grant Count 103
R01 Count 69
Funding $10,224,473.43
PubMed Score 172.92
PubTator Score 118.52

Knowledge Summary

Patent (31,823)

Expression

Synonym

Accession Q12866 Q9HBB4
Symbols MER
RP38
c-Eyk
c-mer
Tyro12

Gene

PDB

2DBJ   2P0C   3BPR   3BRB   3TCP   4M3Q   4MH7   4MHA  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (78)

PMID Text
27122965 We report a novel missense mutation (c.3G>A, p.0?) in the MERTK gene that causes severe vision impairment in a patient.
26990204 One of the associated variants was also found to be linked with increased expression of MERTK in monocytes and higher expression of MERTK was associated with either increased or decreased risk of developing MS, dependent upon HLA-DRB1*15:01 status.
26962228 The current study demonstrates the contribution of the TAM receptor MerTK to the phagocytosis of myelin by human adult microglia and monocyte-derived macrophages.
26819373 Combined Mertk (and Mfge8) deficiency in macrophages blunted VEGFA release from infarcted hearts.
26427488 Data show that activated AMP-activated protein kinase (AMPK) limits retinal pigment epithelial cells (RPE) phagocytic activity by abolishing retinal photoreceptor cell outer segment (POS)-induced activation of c-mer proto-oncogene tyrosine kinase (MerTK).
26427450 Data indicate that AAV2-VMD2-c-mer proto-oncogene protein (hMERTK) provided up to 6.5 months photoreceptor rescue in the RCS rat, and also had a major protective effect in Mertk-null mice.
26427420 Studies indicate that c-Mer receptor tyrosine kinase MERTK mutations cause retinal degenerations.
26316303 Utilizing an ex vivo co-cultivation approach to model key cellular and molecular events found in vivo during infarction, cardiomyocyte phagocytosis was found to be inefficient, in part due to myocyte-induced shedding of macrophage MERTK
26263531 Upon differentiation of these iPSC towards RPE, patient-specific RPE cells exhibited defective phagocytosis, a characteristic phenotype of MERTK deficiency observed in human patients and animal models
25881761 The mRNA expression levels of Tyro-3, Axl were decreased in pSS patients. When considering the plasma level, increased levels of soluble Mer was observed with statistically significant difference.
More...

AA Sequence

MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQP      1 - 70
GRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVPNIYQDTTISWWKDGKELLGA     71 - 140
HHAITQFYPDDEVTAIIASFSITSVQRSDNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTR    141 - 210
NTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINI    211 - 280
KAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQ    281 - 350
ALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGY    351 - 420
RISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTRGGVGPFSDPVKIFIPAHGWVDYAP    421 - 490
SSTPAPGNADPVLIIFGCFCGFILIGLILYISLAIRKRVQETKFGNAFTEEDSELVVNYIAKKSFCRRAI    491 - 560
ELTLHSLGVSEELQNKLEDVVIDRNLLILGKILGEGEFGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQRE    561 - 630
IEEFLSEAACMKDFSHPNVIRLLGVCIEMSSQGIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTL    631 - 700
LKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIE    701 - 770
SLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTD    771 - 840
PLDRPTFSVLRLQLEKLLESLPDVRNQADVIYVNTQLLESSEGLAQGSTLAPLDLNIDPDSIIASCTPRA    841 - 910
AISVVTAEVHDSKPHEGRYILNGGSEEWEDLTSAPSAAVTAEKNSVLPGERLVRNGVSWSHSSMLPLGSS    911 - 980
LPDELLFADDSSEGSEVLM                                                       981 - 999
//

Text Mined References (102)

PMID Year Title
27122965 2016 A novel start codon mutation of the MERTK gene in a patient with retinitis pigmentosa.
26990204 2016 Common and Low Frequency Variants in MERTK Are Independently Associated with Multiple Sclerosis Susceptibility with Discordant Association Dependent upon HLA-DRB1*15:01 Status.
26962228 2016 MerTK Is a Functional Regulator of Myelin Phagocytosis by Human Myeloid Cells.
26819373 2016 Myeloid-Epithelial-Reproductive Receptor Tyrosine Kinase and Milk Fat Globule Epidermal Growth Factor 8 Coordinately Improve Remodeling After Myocardial Infarction via Local Delivery of Vascular Endothelial Growth Factor.
26427488 2016 Blockade of MerTK Activation by AMPK Inhibits RPE Cell Phagocytosis.
26427450 2016 Gene Therapy for MERTK-Associated Retinal Degenerations.
26427420 2016 A Comprehensive Review of Mutations in the MERTK Proto-Oncogene.
26316303 2015 Cardiomyocytes induce macrophage receptor shedding to suppress phagocytosis.
26263531 2015 Human iPSC derived disease model of MERTK-associated retinitis pigmentosa.
25881761 2015 The association of Tyro3/Axl/Mer signaling with inflammatory response, disease activity in patients with primary Sjögren's syndrome.
More...