Property Summary

NCBI Gene PubMed Count 45
Grant Count 1,363
R01 Count 959
Funding $149,232,482.85
PubMed Score 1918.38
PubTator Score 79.84

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q12864 Q15336 Q2M2E0
Symbols HPT1
CDH16
HPT-1

Gene

PANTHER Protein Class (2)

Gene RIF (35)

PMID Text
26497854 Mutations in CDH17 gene is associated with idiopathic hypereosinophilic syndrome.
25834338 Review/Meta-analysis: data reflect the role of CDH17 in tumor proliferation and metastasis among gastric cancer patients.
25768256 CDH17 is a sensitive (81%) and highly specific (100%) marker for metanephric adenoma.
25336636 RGD motif present in cadherin 17 induces integrin activation and tumor growth
24437456 Data suggest that combined tumor expression of CDH17 (cadherin-17) and SATB2 (special AT-rich sequence binding protein 2) may be used as diagnostic biomarkers in subjects with medullary carcinoma of the large intestine (colon; cecum).
23604127 Data reveal a new function for CDH17, which is to regulate alpha2beta1 integrin signaling in cell adhesion and proliferation in colon cancer cells for liver metastasis.
23557862 This study demonstrates that the secreted form of cadherin-17 (ectodomain) is truncated at the C-terminus.
23554857 results identify CDH17 as a biomarker of gastric carcinoma and attractive therapeutic target for this aggressive malignancy.
23326130 The SNPs of the CDH17 gene c.2216 A>C might be clinically important in the prognosis of colorectal carcinoma.
23298905 Cadherin-17 induces tumorigenesis and lymphatic metastasis in gastric cancer through activation of NFkappaB signaling pathway.
More...

AA Sequence

MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIF      1 - 70
VIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIKVKDINDNRPTFLQSKYEGSVRQNSR     71 - 140
PGKPFLYVNATDLDDPATPNGQLYYQIVIQLPMINNVMYFQINNKTGAISLTREGSQELNPAKNPSYNLV    141 - 210
ISVKDMGGQSENSFSDTTSVDIIVTENIWKAPKPVEMVENSTDPHPIKITQVRWNDPGAQYSLVDKEKLP    211 - 280
RFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVKDINDNPPTCPSPVTVFEVQ    281 - 350
ENERLGNSIGTLTAHDRDEENTANSFLNYRIVEQTPKLPMDGLFLIQTYAGMLQLAKQSLKKQDTPQYNL    351 - 420
TIEVSDKDFKTLCFVQINVIDINDQIPIFEKSDYGNLTLAEDTNIGSTILTIQATDADEPFTGSSKILYH    421 - 490
IIKGDSEGRLGVDTDPHTNTGYVIIKKPLDFETAAVSNIVFKAENPEPLVFGVKYNASSFAKFTLIVTDV    491 - 560
NEAPQFSQHVFQAKVSEDVAIGTKVGNVTAKDPEGLDISYSLRGDTRGWLKIDHVTGEIFSVAPLDREAG    561 - 630
SPYRVQVVATEVGGSSLSSVSEFHLILMDVNDNPPRLAKDYTGLFFCHPLSAPGSLIFEATDDDQHLFRG    631 - 700
PHFTFSLGSGSLQNDWEVSKINGTHARLSTRHTEFEEREYVVLIRINDGGRPPLEGIVSLPVTFCSCVEG    701 - 770
SCFRPAGHQTGIPTVGMAVGILLTTLLVIGIILAVVFIRIKKDKGKDNVESAQASEVKPLRS            771 - 832
//

Text Mined References (47)

PMID Year Title
26497854 2015 Whole-exome sequencing and genome-wide methylation analyses identify novel disease associated mutations and methylation patterns in idiopathic hypereosinophilic syndrome.
25834338 2015 Association between cadherin-17 expression and pathological characteristics of gastric cancer: a meta-analysis.
25768256 2015 Cadherin 17 is a sensitive and specific marker for metanephric adenoma.
25336636 2014 An RGD motif present in cadherin 17 induces integrin activation and tumor growth.
24437456 2014 Cadherin-17 and SATB2 are sensitive and specific immunomarkers for medullary carcinoma of the large intestine.
23604127 2014 Cadherin-17 interacts with ?2?1 integrin to regulate cell proliferation and adhesion in colorectal cancer cells causing liver metastasis.
23557862 2013 Detection of cadherin-17 in human colon cancer LIM1215 cell secretome and tumour xenograft-derived interstitial fluid and plasma.
23554857 2013 Targeting CDH17 suppresses tumor progression in gastric cancer by downregulating Wnt/?-catenin signaling.
23326130 2012 Single nucleotide polymorphisms in the CDH17 gene of colorectal carcinoma.
23298905 2013 Cadherin-17 induces tumorigenesis and lymphatic metastasis in gastric cancer through activation of NF?B signaling pathway.
More...