Property Summary

NCBI Gene PubMed Count 41
Grant Count 42
R01 Count 18
Funding $5,045,077.5
PubMed Score 41.88
PubTator Score 38.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Gene RIF (23)

PMID Text
26329426 microRNA-136 targeted and degraded NFIA, which induced the release of microRNA-223, promoting CD11b expression. Direct base pairing occurs between miR-136 and the 3' UTR of NFIA mRNA.
25714559 this family also carried a microdeletion affecting solely the NFIA gene, this study substantiates the importance of this gene in craniofacial development.
25544502 NFI-A is involved in the miR-21-induced expression of IL-10 in B cells in nasopharyngeal carcinoma; Il-10 is capable of suppressing CD8+ T-cell activities.
25265644 RP5-833A20.1/miR-382-5p/NFIA pathway was essential to the regulation of cholesterol homeostasis and inflammatory reactions.
25220407 TGF-beta-mediated suppression of ANT2 through NF1/Smad4 complexes contributes to oxidative stress and DNA damage during induction of cellular senescence.
24560411 a strong candidate gene for asthma and allergic rhinitis
24462883 This report presents the first case of an intragenic deletion within the NFIA gene that is still consistent with classic clinical phenotypes present in previously reported cases of chromosome 1p31.3 related deletion.
24305710 High nuclear factor IA expression is associated with glioblastomas.
23946414 These studies represent the first characterization of miR-223/NFIA axis function in glioma
22925353 These data suggest that genetic variants in the NF1A gene region may predispose to seasonal patterned of mania in bipolar disorder.
More...

AA Sequence

MYSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQK      1 - 70
WASRLLAKLRKDIRPEYREDFVLTVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGI     71 - 140
PLESTDGERLVKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSESPSQPSDADIKDQPENGH    141 - 210
LGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGAMRRSLPSTSSTSSTKRLKS    211 - 280
VEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHH    281 - 350
RPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLKEFVQLVCPDAGQQAGQVGFLNPN    351 - 420
GSSQGKVHNPFLPTPMLPPPPPPPMARPVPLPVPDTKPPTTSTEGGAASPTSPTYSTPSTSPANRFVSVG    421 - 490
PRDPSFVNIPQQTQSWYLG                                                       491 - 509
//

Text Mined References (48)

PMID Year Title
26329426 2016 TNF-?-mediated microRNA-136 induces differentiation of myeloid cells by targeting NFIA.
25714559 2015 Familial craniosynostosis associated with a microdeletion involving the NFIA gene.
25544502 2015 Nasopharyngeal cancer-derived microRNA-21 promotes immune suppressive B cells.
25265644 2015 RP5-833A20.1/miR-382-5p/NFIA-dependent signal transduction pathway contributes to the regulation of cholesterol homeostasis and inflammatory reaction.
25220407 2014 TGF-?/NF1/Smad4-mediated suppression of ANT2 contributes to oxidative stress in cellular senescence.
24560411 2014 The nuclear factor I/A (NFIA) gene is associated with the asthma plus rhinitis phenotype.
24462883 2014 An intragenic deletion of the NFIA gene in a patient with a hypoplastic corpus callosum, craniofacial abnormalities and urinary tract defects.
24305710 2014 A novel tumor-promoting role for nuclear factor IA in glioblastomas is mediated through negative regulation of p53, p21, and PAI1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23946414 2013 The miR-223/nuclear factor I-A axis regulates glial precursor proliferation and tumorigenesis in the CNS.
More...