Property Summary

NCBI Gene PubMed Count 48
PubMed Score 47.38
PubTator Score 38.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid arthritis 1.300 5.4e-04
acute myeloid leukemia -1.100 1.2e-02
adrenocortical carcinoma -1.064 1.2e-04
astrocytic glioma 1.900 2.8e-02
atypical teratoid / rhabdoid tumor 1.100 1.5e-02
Breast cancer -1.500 8.5e-03
breast carcinoma -1.300 4.4e-06
ductal carcinoma in situ -1.200 2.4e-04
ependymoma 1.600 2.6e-02
group 3 medulloblastoma 1.600 4.4e-02
invasive ductal carcinoma -1.323 2.1e-04
lung adenocarcinoma -1.100 1.6e-09
non-small cell lung cancer -1.160 5.7e-10
osteosarcoma -1.446 2.8e-02
ovarian cancer -2.000 2.4e-06
pancreatic ductal adenocarcinoma liver m... -1.280 4.9e-04
Pick disease 1.300 5.0e-05
spina bifida -1.407 4.1e-02
subependymal giant cell astrocytoma -2.121 1.5e-02
tuberculosis 1.100 1.4e-04

Gene RIF (30)

AA Sequence

MYSPLCLTQDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKEEERAVKDELLSEKPEVKQK      1 - 70
WASRLLAKLRKDIRPEYREDFVLTVTGKKPPCCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGI     71 - 140
PLESTDGERLVKSPQCSNPGLCVQPHHIGVSVKELDLYLAYFVHAADSSQSESPSQPSDADIKDQPENGH    141 - 210
LGFQDSFVTSGVFSVTELVRVSQTPIAAGTGPNFSLSDLESSSYYSMSPGAMRRSLPSTSSTSSTKRLKS    211 - 280
VEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHH    281 - 350
RPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLKEFVQLVCPDAGQQAGQVGFLNPN    351 - 420
GSSQGKVHNPFLPTPMLPPPPPPPMARPVPLPVPDTKPPTTSTEGGAASPTSPTYSTPSTSPANRFVSVG    421 - 490
PRDPSFVNIPQQTQSWYLG                                                       491 - 509
//

Text Mined References (56)

PMID Year Title