Property Summary

Ligand Count 377
NCBI Gene PubMed Count 31
PubMed Score 120.96
PubTator Score 77.06

Knowledge Summary

Patent (19,919)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Parkinson's disease 392 3.333 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
group 3 medulloblastoma -1.300 4.1e-03
malignant mesothelioma -1.400 1.1e-05
medulloblastoma, large-cell -1.200 4.4e-04
osteosarcoma -1.831 1.7e-05
ovarian cancer -1.100 4.4e-04
Pick disease -1.200 2.3e-05
psoriasis -1.100 6.8e-04
ulcerative colitis -1.100 3.4e-05

 GWAS Trait (1)

Gene RIF (14)

AA Sequence

MACLHETRTPSPSFGGFVSTLSEASMRKLDPDTSDCTPEKDLTPTHVLQLHEQDAGGPGGAAGSPESRAS      1 - 70
RVRADEVRLQCQSGSGFLEGLFGCLRPVWTMIGKAYSTEHKQQQEDLWEVPFEEILDLQWVGSGAQGAVF     71 - 140
LGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTP    141 - 210
SLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPE    211 - 280
VIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSK    281 - 350
PRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIKSEGTCLHRLEEELVMRRREELR    351 - 420
HALDIREHYERKLERANNLYMELNALMLQLELKERELLRREQALERRCPGLLKPHPSRGLLHGNTMEKLI    421 - 490
KKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDLP    491 - 560
GLRTAVPPHEPGGPGSPGGLGGGPSAWEACPPALRGLHHDLLLRKMSSSSPDLLSAALGSRGRGATGGAG    561 - 630
DPGSPPPARGDTPPSEGSAPGSTSPDSPGGAKGEPPPPVGPGEGVGLLGTGREGTSGRGGSRAGSQHLTP    631 - 700
AALLYRAAVTRSQKRGISSEEEEGEVDSEVELTSSQRWPQSLNMRQSLSTFSSENPSDGEEGTASEPSPS    701 - 770
GTPEVGSTNTDERPDERSDDMCSQGSEIPLDPPPSEVIPGPEPSSLPIPHQELLRERGPPNSEDSDCDST    771 - 840
ELDNSNSVDALRPPASLPP                                                       841 - 859
//

Text Mined References (35)

PMID Year Title