Property Summary

NCBI Gene PubMed Count 29
Grant Count 16
R01 Count 7
Funding $2,693,793.5
PubMed Score 114.87
PubTator Score 77.06

Knowledge Summary

Patent (19,919)

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
psoriasis -2.400 0.000
osteosarcoma -3.313 0.000
group 3 medulloblastoma -1.300 0.004
medulloblastoma, large-cell -1.600 0.000
Pick disease -1.200 0.000
ulcerative colitis -1.100 0.000
ovarian cancer -1.100 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (12)

PMID Text
25999017 miR-130a inhibited the JNK pathway by targeting MAP3K12, contributing to its anti-apoptotic effect and the maintenance of diabetic endothelial progenitor cell function.
25341110 Data suggest that specific pharmacological inhibition of dual leucine zipper kinase (DLK, MAP3K12) may have therapeutic potential in multiple indications of neuronal degeneration.
21893036 these findings indicate that DLK participates in cell proliferation and/or survival, at least in part, by modulating the expression of cell cycle regulatory proteins.
21526495 The results confirm the significance of apoptosis deregulation in CLL, and suggest a possible relationship between ZIPK expression and the clinical course of the disease.
19851984 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19675578 the DLK-ERK signaling pathway may act as a regulator of the interaction that occurs between Hsp27 and the cytoskeleton during the formation of the cornified cell envelope, a process conferring to the skin its crucial barrier function
19146952 Src-dependent tyrosine phosphorylation recombinant human DLK was important for regulation of its activity. DLK may have a role in PDGF signaling.
18995835 DAPK-ZIPK-L13a axis forms a unique regulatory module that first represses, then repermits inflammatory gene expression.
15695824 DLK is a signaling molecule implicated in the regulation of keratinocyte terminal differentiation and cornification
More...

AA Sequence

MACLHETRTPSPSFGGFVSTLSEASMRKLDPDTSDCTPEKDLTPTHVLQLHEQDAGGPGGAAGSPESRAS      1 - 70
RVRADEVRLQCQSGSGFLEGLFGCLRPVWTMIGKAYSTEHKQQQEDLWEVPFEEILDLQWVGSGAQGAVF     71 - 140
LGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRPVTP    141 - 210
SLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPE    211 - 280
VIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCPDGFKILLRQCWNSK    281 - 350
PRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIKSEGTCLHRLEEELVMRRREELR    351 - 420
HALDIREHYERKLERANNLYMELNALMLQLELKERELLRREQALERRCPGLLKPHPSRGLLHGNTMEKLI    421 - 490
KKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDLP    491 - 560
GLRTAVPPHEPGGPGSPGGLGGGPSAWEACPPALRGLHHDLLLRKMSSSSPDLLSAALGSRGRGATGGAG    561 - 630
DPGSPPPARGDTPPSEGSAPGSTSPDSPGGAKGEPPPPVGPGEGVGLLGTGREGTSGRGGSRAGSQHLTP    631 - 700
AALLYRAAVTRSQKRGISSEEEEGEVDSEVELTSSQRWPQSLNMRQSLSTFSSENPSDGEEGTASEPSPS    701 - 770
GTPEVGSTNTDERPDERSDDMCSQGSEIPLDPPPSEVIPGPEPSSLPIPHQELLRERGPPNSEDSDCDST    771 - 840
ELDNSNSVDALRPPASLPP                                                       841 - 859
//

Text Mined References (33)

PMID Year Title
25999017 2015 MicroRNA-130a Targets MAP3K12 to Modulate Diabetic Endothelial Progenitor Cell Function.
25341110 2015 Discovery of dual leucine zipper kinase (DLK, MAP3K12) inhibitors with activity in neurodegeneration models.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21893036 2011 Loss of DLK expression in WI-38 human diploid fibroblasts induces a senescent-like proliferation arrest.
21526495 2011 Assessment of the pathway of apoptosis involving PAR-4, DAXX and ZIPK proteins in CLL patients and its relationship with the principal prognostic factors.
19851984 2010 Genetic variation in MicroRNA genes and risk of oral premalignant lesions.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19675578 2010 The small heat-shock protein Hsp27 undergoes ERK-dependent phosphorylation and redistribution to the cytoskeleton in response to dual leucine zipper-bearing kinase expression.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...