Property Summary

NCBI Gene PubMed Count 20
Grant Count 5
R01 Count 4
Funding $245,445.29
PubMed Score 30.52
PubTator Score 7.39

Knowledge Summary

Patent (9,397)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.034 0.000

Synonym

Accession Q12851 Q86VU3
Symbols GCK
BL44
RAB8IP

Gene

 GWAS Trait (1)

MLP Assay (11)

AID Type Active / Inconclusive / Inactive Description
1530 screening 1006 / 0 / 288933 Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 MEK Kinase 2 mutant
1531 screening 3285 / 165 / 286416 Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 2 Wildtype
1892 screening 145 / 0 / 5797 Single Concentration Confirmation Screen via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 2 Wildtype
1893 screening 117 / 0 / 5825 Single Concentration Confirmation Screen via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 MEK Kinase 2 mutant
1895 confirmatory 58 / 0 / 128 Dose Response Confirmation Screen via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 2 Mutant
1897 confirmatory 93 / 0 / 93 Dose Response Confirmation via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 2 Wildtype
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2150 confirmatory 0 / 0 / 13 Dose Response of SAR compounds via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 2 Wildtype
2151 confirmatory 0 / 0 / 13 SAR Compounds tested by Dose Response Screen via Multiplex HTS Assay for Inhibitors of MEK Kinase PB1 Domains, specifically MEK5 binding to MEK Kinase 2 Mutant.
463089 other 2 / 0 / 4 TR-FRET for modulators of MEKK2-MEK5 PB1 domain interactions
More...

Gene RIF (6)

PMID Text
25075558 Data indicate 4-substituted 1H-pyrrolo[2,3-b]pyridines as potent inhibitors against TGFbeta-activated kinase 1 (TAK1) and mitogen-activated protein kinase kinase kinase kinase 2 (MAP4K2).
24072714 Intermediates in the guanine nucleotide exchange reaction of Rab8 protein catalyzed by guanine nucleotide exchange factors Rabin8 and GRAB.
22433857 Data suggest that the Rabin8-Rab8-Sec15 interaction may couple the activation of Rab8 to the recruitment of the Rab8 effector and is involved in the regulation of vesicular trafficking for primary cilium formation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20332113 CCM3 is located on the Golgi apparatus, forming a complex with proteins of the germinal center kinase III (GCKIII) family and GM130, a Golgi-resident protein.
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALLRDVSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILRECRH      1 - 70
PNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAYVCREALKGLHHLHSQGKIHRDIKGA     71 - 140
NLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAPEVAAVERKGGYNELCDVWALGITAIELGEL    141 - 210
QPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAEKLLQHPFTTQQLPRA    211 - 280
LLTQLLDKASDPHLGTPSPEDCELETYDMFPDTIHSRGQHGPAERTPSEIQFHQVKFGAPRRKETDPLNE    281 - 350
PWEEEWTLLGKEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMGTIKRAPFLGPLPTDPPAEEP    351 - 420
LSSPPGTLPPPPSGPNSSPLLPTAWATMKQREDPERSSCHGLPPTPKVHMGACFSKVFNGCPLRIHAAVT    421 - 490
WIHPVTRDQFLVVGAEEGIYTLNLHELHEDTLEKLISHRCSWLYCVNNVLLSLSGKSTHIWAHDLPGLFE    491 - 560
QRRLQQQVPLSIPTNRLTQRIIPRRFALSTKIPDTKGCLQCRVVRNPYTGATFLLAALPTSLLLLQWYEP    561 - 630
LQKFLLLKNFSSPLPSPAGMLEPLVLDGKELPQVCVGAEGPEGPGCRVLFHVLPLEAGLTPDILIPPEGI    631 - 700
PGSAQQVIQVDRDTILVSFERCVRIVNMQGEPTATLAPELTFDFPIETVVCLQDSVLAFWSHGMQGRSLD    701 - 770
TNEVTQEITDETRIFRVLGAHRDIILESIPTDNPEAHSNLYILTGHQSTY                        771 - 820
//

Text Mined References (30)

PMID Year Title
25075558 2015 Discovery of type II inhibitors of TGF?-activated kinase 1 (TAK1) and mitogen-activated protein kinase kinase kinase kinase 2 (MAP4K2).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24072714 2013 Intermediates in the guanine nucleotide exchange reaction of Rab8 protein catalyzed by guanine nucleotide exchange factors Rabin8 and GRAB.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22433857 2012 A Rab8 guanine nucleotide exchange factor-effector interaction network regulates primary ciliogenesis.
21768215 2011 Genome-wide association study for serum urate concentrations and gout among African Americans identifies genomic risk loci and a novel URAT1 loss-of-function allele.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20332113 2010 CCM3/PDCD10 stabilizes GCKIII proteins to promote Golgi assembly and cell orientation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...