Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.96
PubTator Score 12.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.500 1.5e-05
astrocytic glioma -1.800 1.3e-02
atypical teratoid / rhabdoid tumor -1.100 2.7e-03
ependymoma -1.800 5.0e-02
glioblastoma -1.400 7.9e-04
intraductal papillary-mucinous neoplasm ... 1.100 3.8e-02
lung cancer 1.400 2.4e-03
Multiple myeloma 1.762 4.7e-04
oligodendroglioma -1.600 2.9e-02
osteosarcoma -1.293 9.3e-04
ovarian cancer 2.100 2.5e-04
Waldenstrons macroglobulinemia 1.182 3.0e-02

Gene RIF (7)

AA Sequence

MAGTRWVLGALLRGCGCNCSSCRRTGAACLPFYSAAGSIPSGVSGRRRLLLLLGAAAAAASQTRGLQTGP      1 - 70
VPPGRLAGPPAVATSAAAAAAASYSALRASLLPQSLAAAAAVPTRSYSQESKTTYLEDLPPPPEYELAPS     71 - 140
KLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKAL    141 - 210
EKHRMYMGQRYVEVYEINNEDVDALMKSLQVKSSPVVNDGVVRLRGLPYSCNEKDIVDFFAGLNIVDITF    211 - 280
VMDYRGRRKTGEAYVQFEEPEMANQALLKHREEIGNRYIEIFPSRRNEVRTHVGSYKGKKIASFPTAKYI    281 - 350
TEPEMVFEEHEVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVHMRGLPFQANAQDIINF    351 - 420
FAPLKPVRITMEYSSSGKATGEADVHFETHEDAVAAMLKDRSHVHHRYIELFLNSCPKGK              421 - 480
//

Text Mined References (25)

PMID Year Title