Property Summary

NCBI Gene PubMed Count 15
Grant Count 8
R01 Count 4
Funding $288,973.45
PubMed Score 10.20
PubTator Score 12.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.182 0.030
Multiple myeloma 1.762 0.000
astrocytic glioma -1.800 0.013
ependymoma -1.800 0.050
oligodendroglioma -1.600 0.029
osteosarcoma -1.293 0.001
atypical teratoid / rhabdoid tumor -1.100 0.003
glioblastoma -1.400 0.001
intraductal papillary-mucinous neoplasm ... 1.100 0.038
lung cancer 1.400 0.002
adult high grade glioma -1.500 0.000
ovarian cancer 2.100 0.000

Gene RIF (6)

PMID Text
26507454 MiR-346 depends on GRSF1 to upregulate another target gene.
25184340 Grsf1 controls translation of the protein Use1, possibly by positioning the 40S ribosomal subunit and associated translation factors in front of the translation start site.
23473034 GRSF1 regulates RNA processing in mitochondrial RNA granules.
23473033 The mitochondrial RNA-binding protein GRSF1 localizes to RNA granules and is required for posttranscriptional mitochondrial gene expression.
20877624 Observational study of gene-disease association. (HuGE Navigator)
12239318 GRSF-1 functions by selectively recruiting cellular and viral mRNAs containing 5' UTR GRSF-1 binding sites to polyribosomes, which is mediated through interactions with cellular proteins

AA Sequence

MAGTRWVLGALLRGCGCNCSSCRRTGAACLPFYSAAGSIPSGVSGRRRLLLLLGAAAAAASQTRGLQTGP      1 - 70
VPPGRLAGPPAVATSAAAAAAASYSALRASLLPQSLAAAAAVPTRSYSQESKTTYLEDLPPPPEYELAPS     71 - 140
KLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKAL    141 - 210
EKHRMYMGQRYVEVYEINNEDVDALMKSLQVKSSPVVNDGVVRLRGLPYSCNEKDIVDFFAGLNIVDITF    211 - 280
VMDYRGRRKTGEAYVQFEEPEMANQALLKHREEIGNRYIEIFPSRRNEVRTHVGSYKGKKIASFPTAKYI    281 - 350
TEPEMVFEEHEVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVHMRGLPFQANAQDIINF    351 - 420
FAPLKPVRITMEYSSSGKATGEADVHFETHEDAVAAMLKDRSHVHHRYIELFLNSCPKGK              421 - 480
//

Text Mined References (24)

PMID Year Title
26507454 2015 miR-346 and miR-138 competitively regulate hTERT in GRSF1- and AGO2-dependent manners, respectively.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25683715 2015 Mitochondrial RNA Granules Are Centers for Posttranscriptional RNA Processing and Ribosome Biogenesis.
25184340 2014 Grsf1-induced translation of the SNARE protein Use1 is required for expansion of the erythroid compartment.
23473034 2013 GRSF1 regulates RNA processing in mitochondrial RNA granules.
23473033 2013 The mitochondrial RNA-binding protein GRSF1 localizes to RNA granules and is required for posttranscriptional mitochondrial gene expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...