Property Summary

NCBI Gene PubMed Count 64
PubMed Score 79.06
PubTator Score 74.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 6.0e-08
ovarian cancer 8491 1.6e-06
medulloblastoma, large-cell 6234 1.3e-04
psoriasis 6685 1.3e-04
dermatomyositis 966 3.9e-03
Disease Target Count Z-score Confidence
Tetanus 66 4.031 2.0
Alcoholic pancreatitis 1 3.748 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.500 1.3e-04
osteosarcoma -2.339 6.0e-08
medulloblastoma, large-cell -1.900 1.3e-04
ovarian cancer 1.800 1.6e-06
dermatomyositis 1.500 3.9e-03

 GWAS Trait (1)

Protein-protein Interaction (10)

Gene RIF (15)

PMID Text
25762204 Syntaxin-4 has a role in mediating exocytosis of pre-docked and newcomer insulin granules underlying biphasic glucose-stimulated insulin secretion in human pancreatic beta cells
25673907 When the expression of STX4 mRNA was inhibited with short or small interfering, or silencing, RNA in macrophages, the survival of Brucella melitensis was significantly reduced.
24807903 Increased level of SNAP23-Syntaxin4-VAMP7 interaction correlates with decreased Syntaxin4 phosphorylation and trafficking of MT1-MMP to invadopodia during cellular invasion.
24552216 upregulation of Syntaxin 4 is sufficient to significantly improve insulin secretory function to human type 2 diabetes islets retaining low levels of residual function
24146186 STX4 is implicated in the antibody secretion.
24055037 Syntaxin-4 plays a vital role in exocytosis of IgE from plasma cells. Knock-down of syntaxin-4, but not VAMP3 dramatically reduced IgE secretion from U266 plasma cells causing it to accumulate in the cell.
22226963 These results revealed, for the first time, the extracellular role of syntaxin4 and shed light on the division of the extracellular effects exerted by epimorphin and syntaxin4 on keratinocyte cornification.
21720706 siRNA knockdown (KD) of syntaxins 3 and 4 in HeLa cells reduced cell surface expression of alpha5beta1 and alpha3beta1 integrins
21393240 Syntaxin 4 activation and insulin release in the absence of the glucose stimulus, consistent with nitrosative stress and dysfunctional exocytosis
20959521 Stx4 is an essential postsynaptic component for synaptic plasticity in hippocampal neurons.
20956541 Syntaxin 4 is required for acid sphingomyelinase activity and apoptotic function.
20595382 dysferlin and syntaxin-4 similarly transit a common endosomal pathway in skeletal muscle cells.
20434989 Stx4 defines an exocytic zone that directs membrane fusion for postsynaptic plasticity, revealing a novel specialization for local membrane traffic in dendritic spines.
15351710 syntaxin 4 is involved in the intracellular transport of MT1-MMP toward the plasma membrane
12855681 Syntaxin 4 and Synip (syntaxin 4 interacting protein) regulate insulin secretion in the pancreatic beta HC-9 cells

AA Sequence

MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTIL      1 - 70
ATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINK     71 - 140
CNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEI    141 - 210
QQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV    211 - 280
SITVVLLAVIIGVTVVG                                                         281 - 297
//

Text Mined References (73)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25762204 2015 Syntaxin-4 mediates exocytosis of pre-docked and newcomer insulin granules underlying biphasic glucose-stimulated insulin secretion in human pancreatic beta cells.
25673907 2015 Blocking the expression of syntaxin 4 interferes with initial phagocytosis of Brucella melitensis in macrophages.
25416956 2014 A proteome-scale map of the human interactome network.
24807903 2014 SNAP23, Syntaxin4, and vesicle-associated membrane protein 7 (VAMP7) mediate trafficking of membrane type 1-matrix metalloproteinase (MT1-MMP) during invadopodium formation and tumor cell invasion.
24552216 2014 Syntaxin 4 up-regulation increases efficiency of insulin release in pancreatic islets from humans with and without type 2 diabetes mellitus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24146186 2014 Syntaxin-4 is implicated in the secretion of antibodies by human plasma cells.
24055037 2013 Syntaxin-4 is essential for IgE secretion by plasma cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22226963 2012 The impact of extracellular syntaxin4 on HaCaT keratinocyte behavior.
22153078 2011 Sec22b regulates phagosomal maturation and antigen crosspresentation by dendritic cells.
21720706 2011 Syntaxins 3 and 4 mediate vesicular trafficking of ?5?1 and ?3?1 integrins and cancer cell migration.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21393240 2011 Stimulus-induced S-nitrosylation of Syntaxin 4 impacts insulin granule exocytosis.
21269460 2011 Initial characterization of the human central proteome.
20959521 2010 Role of syntaxin 4 in activity-dependent exocytosis and synaptic plasticity in hippocampal neurons.
20956541 2010 Syntaxin 4 is required for acid sphingomyelinase activity and apoptotic function.
20595382 2010 Reduced plasma membrane expression of dysferlin mutants is attributed to accelerated endocytosis via a syntaxin-4-associated pathway.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20434989 2010 Syntaxin-4 defines a domain for activity-dependent exocytosis in dendritic spines.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19546860 2010 The dysbindin-containing complex (BLOC-1) in brain: developmental regulation, interaction with SNARE proteins and role in neurite outgrowth.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18588921 2008 Involvement of Munc18 isoforms in the regulation of granule exocytosis in neutrophils.
18535201 2008 A genome-wide scan for common genetic variants with a large influence on warfarin maintenance dose.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16677249 2006 A critical role for vesicle-associated membrane protein-7 in exocytosis from human eosinophils and neutrophils.
16339081 2006 Syntaxins 3 and 4 are concentrated in separate clusters on the plasma membrane before the establishment of cell polarity.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15576373 2005 Protease-activated receptor-1 activation of endothelial cells induces protein kinase Calpha-dependent phosphorylation of syntaxin 4 and Munc18c: role in signaling p-selectin expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15351710 2004 Involvement of syntaxin 4 in the transport of membrane-type 1 matrix metalloproteinase to the plasma membrane in human gastric epithelial cells.
15184072 2004 Identification and characterization of taxilin isoforms.
14993220 2004 Identification of SNAREs involved in synaptotagmin VII-regulated lysosomal exocytosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12855681 2003 Syntaxin 4 and Synip (syntaxin 4 interacting protein) regulate insulin secretion in the pancreatic beta HC-9 cell.
12853575 2003 A dual mechanism controlling the localization and function of exocytic v-SNAREs.
12832401 2003 Tomosyn interacts with the t-SNAREs syntaxin4 and SNAP23 and plays a role in insulin-stimulated GLUT4 translocation.
12558796 2003 Taxilin; a novel syntaxin-binding protein that is involved in Ca2+-dependent exocytosis in neuroendocrine cells.
12556468 2003 Homotetrameric structure of the SNAP-23 N-terminal coiled-coil domain.
12517971 2003 Role of vesicle-associated membrane protein-2, through Q-soluble N-ethylmaleimide-sensitive factor attachment protein receptor/R-soluble N-ethylmaleimide-sensitive factor attachment protein receptor interaction, in the exocytosis of specific and tertiary granules of human neutrophils.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435603 2002 Endogenous plasma membrane t-SNARE syntaxin 4 is present in rab11 positive endosomal membranes and associates with cortical actin cytoskeleton.
12417022 2002 Trafficking of green fluorescent protein-tagged SNARE proteins in HSY cells.
12145319 2002 Amisyn, a novel syntaxin-binding protein that may regulate SNARE complex assembly.
12130530 2002 Vesicle-associated membrane protein 3 (VAMP-3) and VAMP-8 are present in human platelets and are required for granule secretion.
11994746 2002 Regulated transport of the glucose transporter GLUT4.
11884531 2002 Rab5a GTPase regulates fusion between pathogen-containing phagosomes and cytoplasmic organelles in human neutrophils.
11880646 2002 A prototypic platelet septin and its participation in secretion.
11842301 2002 Expression of eosinophil target SNAREs as potential cognate receptors for vesicle-associated membrane protein-2 in exocytosis.
11252894 2000 Three ways to make a vesicle.
11063739 2001 Direct interaction of Rab4 with syntaxin 4.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10856305 2000 Protein kinase C phosphorylation of syntaxin 4 in thrombin-activated human platelets.
10820264 2000 Soluble NSF attachment protein receptors (SNAREs) in RBL-2H3 mast cells: functional role of syntaxin 4 in exocytosis and identification of a vesicle-associated membrane protein 8-containing secretory compartment.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
10397765 1999 Functional and biochemical analysis of the C2 domains of synaptotagmin IV.
10394363 1999 Synip: a novel insulin-regulated syntaxin 4-binding protein mediating GLUT4 translocation in adipocytes.
10194441 1999 Human platelets contain SNARE proteins and a Sec1p homologue that interacts with syntaxin 4 and is phosphorylated after thrombin activation: implications for platelet secretion.
10080545 1999 Co-expression of several human syntaxin genes in neutrophils and differentiating HL-60 cells: variant isoforms and detection of syntaxin 1.
9815132 1998 SNAP-23 in rat kidney: colocalization with aquaporin-2 in collecting duct vesicles.
9168999 1997 Inhibition of the binding of SNAP-23 to syntaxin 4 by Munc18c.
9045631 1997 Characterization of Munc-18c and syntaxin-4 in 3T3-L1 adipocytes. Putative role in insulin-dependent movement of GLUT-4.
8973549 1996 Identification of SNAP receptors in rat adipose cell membrane fractions and in SNARE complexes co-immunoprecipitated with epitope-tagged N-ethylmaleimide-sensitive fusion protein.
8770861 1996 Syntaxin-4 is localized to the apical plasma membrane of rat renal collecting duct cells: possible role in aquaporin-2 trafficking.
8760387 1996 Insulin-responsive tissues contain the core complex protein SNAP-25 (synaptosomal-associated protein 25) A and B isoforms in addition to syntaxin 4 and synaptobrevins 1 and 2.
8206394 1994 Isolation and sequence analysis of the human syntaxin-encoding gene.
7791877 1995 Ca(2+)-dependent and -independent activities of neural and non-neural synaptotagmins.
7690687 1993 The syntaxin family of vesicular transport receptors.