Property Summary

NCBI Gene PubMed Count 68
PubMed Score 84.17
PubTator Score 74.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
dermatomyositis 1.500 3.9e-03
medulloblastoma, large-cell -1.900 1.3e-04
osteosarcoma -1.547 2.2e-08
ovarian cancer 1.800 1.6e-06
psoriasis 1.500 1.3e-04

Protein-protein Interaction (5)

Gene RIF (17)

AA Sequence

MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTIL      1 - 70
ATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINK     71 - 140
CNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEI    141 - 210
QQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV    211 - 280
SITVVLLAVIIGVTVVG                                                         281 - 297
//

Text Mined References (77)

PMID Year Title