Property Summary

NCBI Gene PubMed Count 64
Grant Count 67
R01 Count 44
Funding $3,290,927.24
PubMed Score 79.06
PubTator Score 74.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.500 0.000
osteosarcoma -2.339 0.000
medulloblastoma, large-cell -1.900 0.000
ovarian cancer 1.800 0.000
dermatomyositis 1.500 0.004

Synonym

Accession Q12846 A8MXY0 Q15525 Q6FHE8
Symbols STX4A
p35-2

Gene

 GWAS Trait (1)

Gene RIF (15)

PMID Text
25762204 Syntaxin-4 has a role in mediating exocytosis of pre-docked and newcomer insulin granules underlying biphasic glucose-stimulated insulin secretion in human pancreatic beta cells
25673907 When the expression of STX4 mRNA was inhibited with short or small interfering, or silencing, RNA in macrophages, the survival of Brucella melitensis was significantly reduced.
24807903 Increased level of SNAP23-Syntaxin4-VAMP7 interaction correlates with decreased Syntaxin4 phosphorylation and trafficking of MT1-MMP to invadopodia during cellular invasion.
24552216 upregulation of Syntaxin 4 is sufficient to significantly improve insulin secretory function to human type 2 diabetes islets retaining low levels of residual function
24146186 STX4 is implicated in the antibody secretion.
24055037 Syntaxin-4 plays a vital role in exocytosis of IgE from plasma cells. Knock-down of syntaxin-4, but not VAMP3 dramatically reduced IgE secretion from U266 plasma cells causing it to accumulate in the cell.
22226963 These results revealed, for the first time, the extracellular role of syntaxin4 and shed light on the division of the extracellular effects exerted by epimorphin and syntaxin4 on keratinocyte cornification.
21720706 siRNA knockdown (KD) of syntaxins 3 and 4 in HeLa cells reduced cell surface expression of alpha5beta1 and alpha3beta1 integrins
21393240 Syntaxin 4 activation and insulin release in the absence of the glucose stimulus, consistent with nitrosative stress and dysfunctional exocytosis
20959521 Stx4 is an essential postsynaptic component for synaptic plasticity in hippocampal neurons.
More...

AA Sequence

MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTIL      1 - 70
ATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINK     71 - 140
CNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEI    141 - 210
QQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV    211 - 280
SITVVLLAVIIGVTVVG                                                         281 - 297
//

Text Mined References (73)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25762204 2015 Syntaxin-4 mediates exocytosis of pre-docked and newcomer insulin granules underlying biphasic glucose-stimulated insulin secretion in human pancreatic beta cells.
25673907 2015 Blocking the expression of syntaxin 4 interferes with initial phagocytosis of Brucella melitensis in macrophages.
25416956 2014 A proteome-scale map of the human interactome network.
24807903 2014 SNAP23, Syntaxin4, and vesicle-associated membrane protein 7 (VAMP7) mediate trafficking of membrane type 1-matrix metalloproteinase (MT1-MMP) during invadopodium formation and tumor cell invasion.
24552216 2014 Syntaxin 4 up-regulation increases efficiency of insulin release in pancreatic islets from humans with and without type 2 diabetes mellitus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24146186 2014 Syntaxin-4 is implicated in the secretion of antibodies by human plasma cells.
24055037 2013 Syntaxin-4 is essential for IgE secretion by plasma cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...