Property Summary

NCBI Gene PubMed Count 40
Grant Count 36
R01 Count 25
Funding $4,497,421.37
PubMed Score 93.87
PubTator Score 50.14

Knowledge Summary

Patent

No data available

Expression

Gene RIF (26)

PMID Text
26903060 Children with chronic heart failure group had a significantly higher serum level of FSTL1 than the control group.
26375005 data suggest that the loss of epicardial FSTL1 is a maladaptive response to injury, and that its restoration would be an effective way to reverse myocardial death and remodelling following myocardial infarction in humans
26365350 provide mechanistic insight into the regulation of erythropoiesis by FSTL1 signaling and lay a foundation for exploring FSTL1 signaling as a therapeutic target for anemia
26355153 administration of Fstl1 induced airway remodeling and increased OSM, whereas administration of an anti-OSM Ab blocked the effect of Fstl1 on inducing airway remodeling, eosinophilic airway inflammation
25888873 FSTL1 is elevated in patients with osteoarthritis and involved in the progression of synovial inflammation.
25584011 Fstl1 is induced in response to lung injury and promotes the accumulation of myofibroblasts and subsequent fibrosis. These data suggest that Fstl1 may serve as a novel therapeutic target for treatment of progressive lung fibrosis.
24838142 FSTL1 is elevated in various inflammatory conditions and decreased during the course of treatment. FSTL1 may therefore be a valuable biomarker for such diseases.
24470197 These results suggest that FSTL-1 may act on the NLRP3 inflammasome to promote IL-1beta secretion from monocytes/macrophages.
24347831 FSTL1 is a potential mediator of inflammation and insulin resistance in obesity.
23419164 results demonstrated that follistatin-like protein 1 (Fstl1) is expressed and secreted by human myotubes and plasma Fstl1 levels are increased after exercise
More...

AA Sequence

MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG      1 - 70
KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFS     71 - 140
KGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENAD    141 - 210
WKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTE    211 - 280
EEMTRYVQELQKHQETAEKTKRVSTKEI                                              281 - 308
//

Text Mined References (44)

PMID Year Title
26903060 2016 [Change in serum follistatin-like protein 1 and its clinical significance in children with chronic heart failure].
26375005 2015 Epicardial FSTL1 reconstitution regenerates the adult mammalian heart.
26365350 2015 Follistatin-like 1 attenuates differentiation and survival of erythroid cells through Smad2/3 signaling.
26355153 2015 Fstl1 Promotes Asthmatic Airway Remodeling by Inducing Oncostatin M.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25888873 2015 The involvement of follistatin-like protein 1 in osteoarthritis by elevating NF-?B-mediated inflammatory cytokines and enhancing fibroblast like synoviocyte proliferation.
25584011 2015 Blocking follistatin-like 1 attenuates bleomycin-induced pulmonary fibrosis in mice.
25416956 2014 A proteome-scale map of the human interactome network.
24838142 2014 Follistatin-like protein 1 and its role in inflammation and inflammatory diseases.
24470197 2014 Follistatin-like protein 1 enhances NLRP3 inflammasome-mediated IL-1? secretion from monocytes and macrophages.
More...