Property Summary

NCBI Gene PubMed Count 50
PubMed Score 117.50
PubTator Score 50.14

Knowledge Summary

Patent

No data available

Expression

Gene RIF (36)

AA Sequence

MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNG      1 - 70
KTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFS     71 - 140
KGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENAD    141 - 210
WKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTE    211 - 280
EEMTRYVQELQKHQETAEKTKRVSTKEI                                              281 - 308
//

Text Mined References (54)

PMID Year Title